Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UNL6

Protein Details
Accession E4UNL6   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKSTTRKTKRGVEKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
7-27TTRKTKRGVEKKKKDPNAPKR
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKSTTRKTKRGVEKKKKDPNAPKRGLSAYMIFANEQRASVREENPSITFGQVGKVLGERWKALTDKQRKPYEEKAATDKQRYEDEKAAYNSRLEEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.88
4 0.89
5 0.93
6 0.92
7 0.91
8 0.91
9 0.91
10 0.91
11 0.86
12 0.78
13 0.71
14 0.65
15 0.56
16 0.47
17 0.38
18 0.29
19 0.25
20 0.23
21 0.18
22 0.17
23 0.17
24 0.15
25 0.13
26 0.11
27 0.1
28 0.15
29 0.17
30 0.19
31 0.18
32 0.19
33 0.21
34 0.21
35 0.21
36 0.17
37 0.14
38 0.12
39 0.1
40 0.1
41 0.09
42 0.08
43 0.07
44 0.07
45 0.08
46 0.1
47 0.11
48 0.11
49 0.12
50 0.14
51 0.15
52 0.19
53 0.28
54 0.35
55 0.43
56 0.52
57 0.58
58 0.58
59 0.64
60 0.69
61 0.7
62 0.66
63 0.61
64 0.59
65 0.61
66 0.64
67 0.62
68 0.57
69 0.49
70 0.51
71 0.52
72 0.5
73 0.47
74 0.44
75 0.46
76 0.47
77 0.48
78 0.42
79 0.4
80 0.35
81 0.31
82 0.3