Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139I7Y3

Protein Details
Accession A0A139I7Y3    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
47-72VVVAGRRKKKELKARKKNLNRCEELGHydrophilic
NLS Segment(s)
PositionSequence
51-63GRRKKKELKARKK
Subcellular Location(s) nucl 12, cyto_nucl 10.5, cyto 7, mito 6
Family & Domain DBs
Amino Acid Sequences MILTDEPKQAASPSRCPYRSTVPSQKRLCLRGIFNWNGRAEAVSRWVVVAGRRKKKELKARKKNLNRCEELGPTAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.49
4 0.52
5 0.52
6 0.54
7 0.55
8 0.59
9 0.58
10 0.66
11 0.67
12 0.68
13 0.64
14 0.59
15 0.54
16 0.48
17 0.42
18 0.39
19 0.44
20 0.42
21 0.39
22 0.41
23 0.37
24 0.33
25 0.3
26 0.23
27 0.17
28 0.14
29 0.14
30 0.1
31 0.1
32 0.1
33 0.1
34 0.11
35 0.14
36 0.23
37 0.29
38 0.38
39 0.41
40 0.46
41 0.54
42 0.62
43 0.69
44 0.71
45 0.73
46 0.75
47 0.83
48 0.89
49 0.92
50 0.93
51 0.92
52 0.91
53 0.85
54 0.78
55 0.73
56 0.65