Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139IA72

Protein Details
Accession A0A139IA72   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
38-65LSPSPKKSTKGKSARKRAKKQPDKALEIHydrophilic
NLS Segment(s)
PositionSequence
42-59PKKSTKGKSARKRAKKQP
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MIMVPKSSRKRKAPAPDFGQDTDEDEEPTEEKSEDDGLSPSPKKSTKGKSARKRAKKQPDKALEISDPVTPTKQTGKTSAAVTCSEAYLLIGDYLLVSTYNHNQTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.76
3 0.74
4 0.7
5 0.63
6 0.56
7 0.44
8 0.39
9 0.32
10 0.25
11 0.19
12 0.16
13 0.15
14 0.13
15 0.14
16 0.12
17 0.09
18 0.09
19 0.1
20 0.11
21 0.1
22 0.11
23 0.1
24 0.1
25 0.15
26 0.16
27 0.16
28 0.18
29 0.2
30 0.23
31 0.3
32 0.36
33 0.42
34 0.51
35 0.61
36 0.67
37 0.76
38 0.83
39 0.86
40 0.88
41 0.88
42 0.88
43 0.88
44 0.87
45 0.86
46 0.84
47 0.79
48 0.72
49 0.65
50 0.54
51 0.46
52 0.38
53 0.29
54 0.22
55 0.17
56 0.16
57 0.12
58 0.13
59 0.18
60 0.21
61 0.22
62 0.25
63 0.28
64 0.29
65 0.32
66 0.32
67 0.28
68 0.24
69 0.24
70 0.2
71 0.17
72 0.15
73 0.12
74 0.11
75 0.09
76 0.08
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.09
86 0.16