Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139IAH0

Protein Details
Accession A0A139IAH0   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
66-90GVEARVRSKRRRNDKKDKEVWQKDFBasic
NLS Segment(s)
PositionSequence
72-81RSKRRRNDKK
Subcellular Location(s) nucl 17.5, cyto_nucl 11.833, mito_nucl 11.666, mito 4.5
Family & Domain DBs
Amino Acid Sequences MHAASLGHCKSRRIQLRGNCEERQPWSSKVREPPATSLPTHNHNTDTIYGGRHDIQRIFSSELGMGVEARVRSKRRRNDKKDKEVWQKDFMLDRTISLEPTTTYTKQPQPQPTTLKTFQQKCKITGPRLGSVITIKATQSLRDHLPNEPHCEMWSSKLTQGDASNFEEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.6
3 0.69
4 0.76
5 0.77
6 0.69
7 0.63
8 0.6
9 0.56
10 0.53
11 0.47
12 0.42
13 0.43
14 0.45
15 0.48
16 0.53
17 0.56
18 0.58
19 0.56
20 0.57
21 0.56
22 0.55
23 0.5
24 0.46
25 0.41
26 0.4
27 0.4
28 0.36
29 0.31
30 0.28
31 0.29
32 0.25
33 0.25
34 0.2
35 0.17
36 0.16
37 0.16
38 0.18
39 0.18
40 0.19
41 0.17
42 0.19
43 0.2
44 0.22
45 0.23
46 0.2
47 0.19
48 0.17
49 0.16
50 0.13
51 0.11
52 0.08
53 0.05
54 0.07
55 0.06
56 0.08
57 0.12
58 0.16
59 0.24
60 0.33
61 0.42
62 0.52
63 0.63
64 0.72
65 0.79
66 0.86
67 0.89
68 0.88
69 0.89
70 0.88
71 0.85
72 0.79
73 0.72
74 0.62
75 0.53
76 0.48
77 0.39
78 0.31
79 0.23
80 0.19
81 0.18
82 0.17
83 0.16
84 0.12
85 0.12
86 0.09
87 0.12
88 0.16
89 0.14
90 0.16
91 0.21
92 0.27
93 0.33
94 0.39
95 0.45
96 0.47
97 0.52
98 0.56
99 0.55
100 0.57
101 0.54
102 0.54
103 0.53
104 0.55
105 0.57
106 0.6
107 0.6
108 0.55
109 0.63
110 0.63
111 0.59
112 0.58
113 0.55
114 0.49
115 0.47
116 0.44
117 0.35
118 0.29
119 0.27
120 0.21
121 0.17
122 0.14
123 0.17
124 0.17
125 0.19
126 0.21
127 0.23
128 0.26
129 0.31
130 0.33
131 0.33
132 0.42
133 0.43
134 0.48
135 0.45
136 0.42
137 0.37
138 0.39
139 0.35
140 0.31
141 0.32
142 0.27
143 0.29
144 0.32
145 0.32
146 0.32
147 0.34
148 0.33
149 0.32