Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A139IRF5

Protein Details
Accession A0A139IRF5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
85-108LKKLMFWKKDKKPEEPPKKEDAKTBasic
NLS Segment(s)
PositionSequence
60-103KAGKPTTKTAKAVAGREKKGTPGDLLKKLMFWKKDKKPEEPPKK
Subcellular Location(s) cyto 14.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MSDQKVVEQSASTGGALGELNAAPVEASVNGPSGAPAPATTQASEPAAANKMESKLEASKAGKPTTKTAKAVAGREKKGTPGDLLKKLMFWKKDKKPEEPPKKEDAKTATQEAVTGATTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.08
5 0.07
6 0.06
7 0.06
8 0.06
9 0.06
10 0.05
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.07
17 0.07
18 0.07
19 0.07
20 0.08
21 0.08
22 0.07
23 0.07
24 0.08
25 0.11
26 0.12
27 0.13
28 0.12
29 0.13
30 0.14
31 0.14
32 0.12
33 0.11
34 0.12
35 0.11
36 0.11
37 0.11
38 0.11
39 0.11
40 0.11
41 0.12
42 0.12
43 0.13
44 0.17
45 0.17
46 0.2
47 0.23
48 0.26
49 0.25
50 0.25
51 0.3
52 0.34
53 0.37
54 0.34
55 0.32
56 0.37
57 0.38
58 0.41
59 0.45
60 0.44
61 0.42
62 0.44
63 0.42
64 0.39
65 0.37
66 0.34
67 0.27
68 0.28
69 0.33
70 0.35
71 0.37
72 0.34
73 0.34
74 0.38
75 0.42
76 0.39
77 0.39
78 0.45
79 0.52
80 0.62
81 0.65
82 0.68
83 0.73
84 0.79
85 0.83
86 0.82
87 0.78
88 0.77
89 0.8
90 0.74
91 0.69
92 0.64
93 0.62
94 0.58
95 0.56
96 0.49
97 0.4
98 0.39
99 0.33
100 0.28