Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098CZH1

Protein Details
Accession A0A098CZH1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-54RFKHTLSERWTRKKKRNSPSPGLEHydrophilic
NLS Segment(s)
PositionSequence
40-47WTRKKKRN
Subcellular Location(s) mito_nucl 12.166, mito 12, nucl 10, cyto_nucl 8.166, cyto 4
Family & Domain DBs
Amino Acid Sequences MNPRRPLPVANGNVTTTPTRAFVTEDIEKPRFKHTLSERWTRKKKRNSPSPGLEPGSFTPRRASRFNTYPFSMDVLPLHQLGLLRCCSFNLCISYCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.33
3 0.24
4 0.2
5 0.17
6 0.15
7 0.14
8 0.16
9 0.14
10 0.19
11 0.23
12 0.25
13 0.3
14 0.32
15 0.33
16 0.32
17 0.35
18 0.32
19 0.27
20 0.32
21 0.33
22 0.4
23 0.45
24 0.54
25 0.57
26 0.65
27 0.74
28 0.75
29 0.77
30 0.78
31 0.83
32 0.83
33 0.85
34 0.84
35 0.82
36 0.8
37 0.76
38 0.7
39 0.63
40 0.53
41 0.44
42 0.37
43 0.36
44 0.29
45 0.24
46 0.25
47 0.26
48 0.3
49 0.31
50 0.35
51 0.36
52 0.44
53 0.49
54 0.48
55 0.46
56 0.43
57 0.41
58 0.38
59 0.3
60 0.24
61 0.19
62 0.15
63 0.15
64 0.14
65 0.13
66 0.11
67 0.12
68 0.13
69 0.16
70 0.17
71 0.17
72 0.17
73 0.18
74 0.2
75 0.2
76 0.23
77 0.24