Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RWL7

Protein Details
Accession I1RWL7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
216-242SSSGGYSGRSWRRRRSVRSTNGYEGRRHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 22, mito 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009571  SUR7/Rim9-like_fungi  
Gene Ontology GO:0005886  C:plasma membrane  
KEGG fgr:FGSG_08692  -  
Pfam View protein in Pfam  
PF06687  SUR7  
Amino Acid Sequences MAKNAPLGLAGLVLMAVSLLFLWFIILSGLTSTTPFDKTYFLRADTSDITGARDTTQWNFFYICGAGNNDCDGARAAPVIGKAWDSNPRNAPSSLVGGRAGDTTSNRQFFLWRFGWVFILITLFFETIAFFTGFIACCGRLGAGISGFTSMFALLCSSVAMSLMTATWVLARNAFKSAGRSASIGRYAFGFAWASWAALFIATILFCLGMRGDKSSSSGGYSGRSWRRRRSVRSTNGYEGRRVKDDYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.02
5 0.02
6 0.02
7 0.02
8 0.03
9 0.03
10 0.03
11 0.04
12 0.04
13 0.04
14 0.04
15 0.05
16 0.06
17 0.06
18 0.07
19 0.08
20 0.1
21 0.12
22 0.13
23 0.13
24 0.16
25 0.18
26 0.25
27 0.27
28 0.27
29 0.27
30 0.27
31 0.3
32 0.28
33 0.28
34 0.23
35 0.2
36 0.2
37 0.19
38 0.18
39 0.15
40 0.15
41 0.15
42 0.16
43 0.2
44 0.19
45 0.19
46 0.2
47 0.18
48 0.19
49 0.17
50 0.14
51 0.11
52 0.13
53 0.13
54 0.13
55 0.13
56 0.12
57 0.12
58 0.12
59 0.11
60 0.09
61 0.08
62 0.08
63 0.07
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.09
70 0.11
71 0.2
72 0.21
73 0.25
74 0.3
75 0.32
76 0.34
77 0.34
78 0.33
79 0.26
80 0.28
81 0.23
82 0.19
83 0.17
84 0.14
85 0.14
86 0.13
87 0.12
88 0.08
89 0.09
90 0.13
91 0.18
92 0.19
93 0.19
94 0.18
95 0.2
96 0.2
97 0.26
98 0.21
99 0.18
100 0.18
101 0.18
102 0.19
103 0.17
104 0.16
105 0.09
106 0.09
107 0.07
108 0.06
109 0.06
110 0.05
111 0.05
112 0.05
113 0.05
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.06
121 0.07
122 0.07
123 0.06
124 0.06
125 0.06
126 0.06
127 0.05
128 0.06
129 0.06
130 0.05
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.03
149 0.03
150 0.03
151 0.04
152 0.04
153 0.04
154 0.05
155 0.07
156 0.07
157 0.11
158 0.12
159 0.13
160 0.15
161 0.16
162 0.16
163 0.17
164 0.2
165 0.19
166 0.19
167 0.19
168 0.19
169 0.21
170 0.25
171 0.22
172 0.2
173 0.18
174 0.18
175 0.17
176 0.17
177 0.14
178 0.09
179 0.13
180 0.13
181 0.12
182 0.1
183 0.11
184 0.09
185 0.08
186 0.08
187 0.04
188 0.05
189 0.05
190 0.05
191 0.04
192 0.05
193 0.04
194 0.05
195 0.06
196 0.08
197 0.09
198 0.12
199 0.13
200 0.14
201 0.17
202 0.19
203 0.19
204 0.18
205 0.19
206 0.17
207 0.19
208 0.21
209 0.27
210 0.35
211 0.43
212 0.48
213 0.57
214 0.66
215 0.73
216 0.8
217 0.82
218 0.83
219 0.85
220 0.88
221 0.85
222 0.84
223 0.83
224 0.76
225 0.73
226 0.69
227 0.64
228 0.59