Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RM22

Protein Details
Accession I1RM22    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
36-56QGLAKPGSRRKPKALVHRGPTHydrophilic
NLS Segment(s)
PositionSequence
40-52KPGSRRKPKALVH
Subcellular Location(s) cyto 13.5, cyto_nucl 12, nucl 9.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018606  Arb1  
Gene Ontology GO:0033167  C:ARC complex  
GO:0031047  P:RNA-mediated gene silencing  
KEGG fgr:FGSG_04997  -  
Pfam View protein in Pfam  
PF09692  Arb1  
Amino Acid Sequences MATPTDDTPAIQDKENIKNEDAEYLGPPPALPASLQGLAKPGSRRKPKALVHRGPTALPKNRGTGFEEFFADPPMTPDEAKEEKDEIYAPRMQACIQRFRSRRRLQGARILYFDEYLFLGGVDCQPNNFGGLSQKELKELTPAERRDATAKDVIWASSAAGEKFYNGDEENWTVDFAGVAAGFFSVTLVHLTSSEQKRMLEGISTVENFLRYVLQHSVCPEYEDDVKAAMEVCKVAAEEWPMFQELCAALPGQFNLAAAELYCPEETIEQSWSFLDFKRPKDFDPISVFFTAFALMDEPELFERLATKQPTVTREFKCTLELVQTFRPSDDIIKRVKSLVIADKAAYHVPVGKATFKQGVIEDDWEKPPTSWPIDEETMTLFFDDHLLARMWPGMRIEANICELDAGLRFITSIENIVPSFYVFLPQEMMRHYKEPKENDRPAPSVNDPQQDGNENGGGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.5
4 0.43
5 0.46
6 0.45
7 0.42
8 0.37
9 0.29
10 0.24
11 0.22
12 0.22
13 0.17
14 0.16
15 0.14
16 0.14
17 0.13
18 0.11
19 0.11
20 0.15
21 0.19
22 0.19
23 0.18
24 0.21
25 0.22
26 0.26
27 0.31
28 0.35
29 0.41
30 0.52
31 0.58
32 0.63
33 0.71
34 0.75
35 0.79
36 0.82
37 0.81
38 0.77
39 0.78
40 0.72
41 0.64
42 0.65
43 0.63
44 0.6
45 0.57
46 0.54
47 0.51
48 0.52
49 0.52
50 0.48
51 0.45
52 0.39
53 0.35
54 0.36
55 0.31
56 0.29
57 0.28
58 0.24
59 0.17
60 0.17
61 0.18
62 0.16
63 0.15
64 0.15
65 0.2
66 0.23
67 0.25
68 0.25
69 0.24
70 0.23
71 0.24
72 0.26
73 0.21
74 0.22
75 0.24
76 0.22
77 0.22
78 0.22
79 0.23
80 0.26
81 0.29
82 0.34
83 0.37
84 0.46
85 0.5
86 0.59
87 0.68
88 0.69
89 0.74
90 0.74
91 0.77
92 0.73
93 0.76
94 0.75
95 0.67
96 0.61
97 0.54
98 0.45
99 0.36
100 0.3
101 0.21
102 0.13
103 0.1
104 0.09
105 0.06
106 0.06
107 0.06
108 0.09
109 0.1
110 0.09
111 0.09
112 0.1
113 0.1
114 0.11
115 0.11
116 0.09
117 0.12
118 0.14
119 0.18
120 0.22
121 0.22
122 0.22
123 0.23
124 0.22
125 0.22
126 0.22
127 0.24
128 0.28
129 0.29
130 0.31
131 0.32
132 0.33
133 0.32
134 0.32
135 0.3
136 0.25
137 0.24
138 0.22
139 0.21
140 0.2
141 0.17
142 0.16
143 0.12
144 0.11
145 0.12
146 0.1
147 0.11
148 0.11
149 0.1
150 0.11
151 0.11
152 0.1
153 0.09
154 0.1
155 0.1
156 0.12
157 0.13
158 0.12
159 0.12
160 0.1
161 0.09
162 0.08
163 0.06
164 0.05
165 0.04
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.04
175 0.04
176 0.04
177 0.05
178 0.06
179 0.14
180 0.16
181 0.18
182 0.19
183 0.19
184 0.19
185 0.2
186 0.19
187 0.12
188 0.1
189 0.1
190 0.1
191 0.1
192 0.1
193 0.1
194 0.1
195 0.09
196 0.08
197 0.07
198 0.06
199 0.08
200 0.11
201 0.12
202 0.13
203 0.14
204 0.17
205 0.16
206 0.17
207 0.14
208 0.13
209 0.14
210 0.14
211 0.12
212 0.1
213 0.1
214 0.09
215 0.09
216 0.07
217 0.06
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.06
224 0.07
225 0.07
226 0.08
227 0.09
228 0.09
229 0.09
230 0.08
231 0.09
232 0.06
233 0.06
234 0.06
235 0.06
236 0.06
237 0.07
238 0.07
239 0.06
240 0.06
241 0.06
242 0.06
243 0.06
244 0.05
245 0.04
246 0.05
247 0.05
248 0.06
249 0.06
250 0.06
251 0.06
252 0.07
253 0.07
254 0.08
255 0.1
256 0.09
257 0.09
258 0.09
259 0.1
260 0.11
261 0.11
262 0.19
263 0.22
264 0.26
265 0.35
266 0.36
267 0.36
268 0.44
269 0.45
270 0.41
271 0.44
272 0.42
273 0.36
274 0.36
275 0.34
276 0.25
277 0.24
278 0.18
279 0.11
280 0.09
281 0.06
282 0.05
283 0.06
284 0.06
285 0.06
286 0.06
287 0.07
288 0.07
289 0.06
290 0.07
291 0.09
292 0.15
293 0.16
294 0.16
295 0.19
296 0.23
297 0.28
298 0.32
299 0.38
300 0.35
301 0.39
302 0.41
303 0.38
304 0.36
305 0.33
306 0.28
307 0.27
308 0.26
309 0.24
310 0.26
311 0.28
312 0.26
313 0.25
314 0.25
315 0.19
316 0.24
317 0.25
318 0.25
319 0.27
320 0.29
321 0.3
322 0.3
323 0.3
324 0.26
325 0.25
326 0.28
327 0.27
328 0.26
329 0.25
330 0.25
331 0.26
332 0.25
333 0.2
334 0.13
335 0.13
336 0.13
337 0.16
338 0.16
339 0.18
340 0.19
341 0.22
342 0.26
343 0.22
344 0.23
345 0.21
346 0.23
347 0.21
348 0.25
349 0.24
350 0.23
351 0.25
352 0.25
353 0.24
354 0.21
355 0.24
356 0.25
357 0.27
358 0.25
359 0.25
360 0.29
361 0.31
362 0.31
363 0.27
364 0.24
365 0.21
366 0.19
367 0.17
368 0.11
369 0.09
370 0.1
371 0.1
372 0.08
373 0.09
374 0.09
375 0.09
376 0.1
377 0.13
378 0.13
379 0.14
380 0.15
381 0.16
382 0.16
383 0.18
384 0.2
385 0.19
386 0.21
387 0.19
388 0.18
389 0.15
390 0.14
391 0.13
392 0.11
393 0.1
394 0.08
395 0.07
396 0.07
397 0.08
398 0.09
399 0.09
400 0.1
401 0.09
402 0.11
403 0.11
404 0.12
405 0.12
406 0.11
407 0.13
408 0.11
409 0.15
410 0.13
411 0.14
412 0.17
413 0.17
414 0.19
415 0.21
416 0.26
417 0.25
418 0.3
419 0.34
420 0.39
421 0.47
422 0.54
423 0.61
424 0.66
425 0.72
426 0.75
427 0.78
428 0.72
429 0.67
430 0.65
431 0.6
432 0.59
433 0.58
434 0.55
435 0.5
436 0.49
437 0.5
438 0.47
439 0.43
440 0.37
441 0.32