Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RQR3

Protein Details
Accession I1RQR3   
Localization Confidence High
Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
235-258VDRDERRRSPSRSHSRSRSRSRSPBasic
NLS Segment(s)
PositionSequence
146-153RKLRRRGR
240-258RRRSPSRSHSRSRSRSRSP
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005037  PRP38  
Gene Ontology GO:0071011  C:precatalytic spliceosome  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG fgr:FGSG_06411  -  
Pfam View protein in Pfam  
PF03371  PRP38  
Amino Acid Sequences MSRDKDTVHADARRFLDERGSNVSVAPNGLNPATIMEKAVRDRIVDSIYYKMQCFACNEADIVDRVVEDVKFIGGTYGTTQVPSPFLCLAFKLLELSPSDAVLLEYLKFGGEAFKYLRALACFYFRLTRQAKNVYEMLEPFLEDRRKLRRRGREGVKLSYMDEFVDDLLTKERVCGTSLWKMPKREVLEDLEILEPRVSPLGDLEDLLEEEHEAEKENGTREESEEISEGDVMEVDRDERRRSPSRSHSRSRSRSRSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.38
4 0.34
5 0.36
6 0.37
7 0.36
8 0.32
9 0.31
10 0.33
11 0.24
12 0.23
13 0.2
14 0.13
15 0.13
16 0.13
17 0.12
18 0.11
19 0.12
20 0.13
21 0.13
22 0.13
23 0.13
24 0.16
25 0.19
26 0.23
27 0.22
28 0.2
29 0.21
30 0.23
31 0.23
32 0.21
33 0.2
34 0.2
35 0.23
36 0.24
37 0.23
38 0.24
39 0.23
40 0.24
41 0.25
42 0.25
43 0.23
44 0.23
45 0.23
46 0.2
47 0.2
48 0.18
49 0.16
50 0.12
51 0.09
52 0.08
53 0.1
54 0.08
55 0.07
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.07
64 0.1
65 0.09
66 0.1
67 0.11
68 0.11
69 0.12
70 0.12
71 0.13
72 0.1
73 0.11
74 0.11
75 0.11
76 0.13
77 0.11
78 0.11
79 0.11
80 0.1
81 0.11
82 0.12
83 0.14
84 0.12
85 0.11
86 0.11
87 0.09
88 0.09
89 0.07
90 0.07
91 0.05
92 0.05
93 0.05
94 0.05
95 0.04
96 0.04
97 0.06
98 0.05
99 0.07
100 0.08
101 0.1
102 0.11
103 0.11
104 0.12
105 0.11
106 0.12
107 0.11
108 0.13
109 0.11
110 0.12
111 0.14
112 0.14
113 0.21
114 0.22
115 0.24
116 0.26
117 0.32
118 0.32
119 0.33
120 0.34
121 0.28
122 0.26
123 0.23
124 0.2
125 0.14
126 0.13
127 0.11
128 0.14
129 0.13
130 0.13
131 0.17
132 0.26
133 0.32
134 0.4
135 0.48
136 0.53
137 0.61
138 0.7
139 0.75
140 0.75
141 0.74
142 0.7
143 0.65
144 0.55
145 0.48
146 0.39
147 0.3
148 0.2
149 0.15
150 0.11
151 0.07
152 0.07
153 0.06
154 0.06
155 0.08
156 0.08
157 0.08
158 0.08
159 0.1
160 0.1
161 0.11
162 0.12
163 0.15
164 0.22
165 0.27
166 0.36
167 0.4
168 0.41
169 0.42
170 0.48
171 0.48
172 0.43
173 0.42
174 0.38
175 0.36
176 0.34
177 0.33
178 0.28
179 0.24
180 0.21
181 0.18
182 0.12
183 0.09
184 0.1
185 0.08
186 0.07
187 0.08
188 0.1
189 0.1
190 0.11
191 0.11
192 0.1
193 0.1
194 0.1
195 0.09
196 0.06
197 0.07
198 0.08
199 0.07
200 0.09
201 0.09
202 0.11
203 0.14
204 0.16
205 0.17
206 0.19
207 0.2
208 0.19
209 0.22
210 0.21
211 0.2
212 0.19
213 0.17
214 0.16
215 0.15
216 0.13
217 0.1
218 0.1
219 0.08
220 0.07
221 0.07
222 0.08
223 0.13
224 0.16
225 0.21
226 0.25
227 0.33
228 0.41
229 0.46
230 0.55
231 0.61
232 0.69
233 0.74
234 0.8
235 0.82
236 0.85
237 0.9
238 0.91