Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1S871

Protein Details
Accession I1S871    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
134-156AHHNKDRETRKQKLKKYYAVPRVBasic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
KEGG fgr:FGSG_13049  -  
Amino Acid Sequences MGSPAPANGTLDSPWLGAYKPSSWGFQVPLGPGCWAARGLRAFTPLLSLSLSSGSRGDEILGPRAQQGAIPRLRWMEYRTTEAEDAQQWGELPHVTSNCMPFSALSLFVLGCIRPAPATPKPTQWSSSIHVFAAHHNKDRETRKQKLKKYYAVPRVSLRPLPTLMNMDKANLLNGACRDDLLLVMVGACLPTSSSHAKPLYREQGFIHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.15
6 0.14
7 0.2
8 0.21
9 0.22
10 0.24
11 0.26
12 0.26
13 0.26
14 0.28
15 0.24
16 0.24
17 0.23
18 0.22
19 0.2
20 0.18
21 0.16
22 0.14
23 0.12
24 0.16
25 0.17
26 0.19
27 0.19
28 0.22
29 0.21
30 0.19
31 0.22
32 0.17
33 0.16
34 0.14
35 0.12
36 0.1
37 0.12
38 0.12
39 0.1
40 0.1
41 0.1
42 0.1
43 0.1
44 0.1
45 0.11
46 0.12
47 0.16
48 0.16
49 0.16
50 0.16
51 0.16
52 0.15
53 0.13
54 0.15
55 0.19
56 0.21
57 0.22
58 0.22
59 0.23
60 0.25
61 0.25
62 0.24
63 0.24
64 0.23
65 0.27
66 0.27
67 0.28
68 0.28
69 0.26
70 0.25
71 0.18
72 0.18
73 0.13
74 0.12
75 0.09
76 0.09
77 0.09
78 0.07
79 0.07
80 0.07
81 0.08
82 0.09
83 0.1
84 0.11
85 0.11
86 0.11
87 0.1
88 0.08
89 0.1
90 0.09
91 0.08
92 0.07
93 0.07
94 0.07
95 0.07
96 0.07
97 0.05
98 0.05
99 0.05
100 0.05
101 0.04
102 0.05
103 0.11
104 0.15
105 0.2
106 0.22
107 0.27
108 0.3
109 0.32
110 0.34
111 0.3
112 0.3
113 0.29
114 0.32
115 0.28
116 0.25
117 0.24
118 0.23
119 0.25
120 0.3
121 0.29
122 0.29
123 0.3
124 0.31
125 0.37
126 0.43
127 0.49
128 0.48
129 0.55
130 0.61
131 0.69
132 0.75
133 0.79
134 0.81
135 0.78
136 0.79
137 0.8
138 0.79
139 0.75
140 0.7
141 0.64
142 0.61
143 0.57
144 0.51
145 0.43
146 0.36
147 0.33
148 0.32
149 0.29
150 0.29
151 0.26
152 0.28
153 0.26
154 0.24
155 0.25
156 0.23
157 0.22
158 0.17
159 0.17
160 0.15
161 0.16
162 0.18
163 0.15
164 0.15
165 0.14
166 0.13
167 0.13
168 0.11
169 0.1
170 0.07
171 0.07
172 0.07
173 0.06
174 0.06
175 0.05
176 0.04
177 0.04
178 0.05
179 0.1
180 0.16
181 0.17
182 0.25
183 0.3
184 0.33
185 0.37
186 0.46
187 0.51
188 0.48
189 0.49