Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E5R0U4

Protein Details
Accession E5R0U4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-54NRSIEKSGAARRRRNRKRNARASFSRVSFHydrophilic
NLS Segment(s)
PositionSequence
31-46KSGAARRRRNRKRNAR
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003615  HNH_nuc  
CDD cd00085  HNHc  
Amino Acid Sequences MTGLIKNEAKENYGIFRECVSKSILNRSIEKSGAARRRRNRKRNARASFSRVSFPDDNDPAELAEFIDFVAQEMFRSFPENVQTLSYNAIQSSPALADTYAGGISGNTIDFLASLVDPSISESLVTYGLMSEASDLTTMLCSIFMEFSSTVTAKPPPFSATRTTACEICERDWIPLTYHHLIPKAVHSKALKRGWHEECDLNQVAWLCRACHSYVHRMASNEELAREWYTVEAILGREDTQEWAKWAGRLRWKSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.24
3 0.26
4 0.28
5 0.26
6 0.26
7 0.26
8 0.26
9 0.28
10 0.38
11 0.42
12 0.41
13 0.45
14 0.48
15 0.47
16 0.43
17 0.42
18 0.36
19 0.39
20 0.44
21 0.48
22 0.53
23 0.59
24 0.7
25 0.79
26 0.85
27 0.87
28 0.89
29 0.91
30 0.93
31 0.92
32 0.91
33 0.87
34 0.85
35 0.81
36 0.72
37 0.65
38 0.55
39 0.53
40 0.45
41 0.4
42 0.4
43 0.34
44 0.33
45 0.29
46 0.28
47 0.21
48 0.2
49 0.17
50 0.09
51 0.08
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.05
59 0.06
60 0.06
61 0.07
62 0.07
63 0.11
64 0.1
65 0.12
66 0.15
67 0.16
68 0.16
69 0.18
70 0.18
71 0.15
72 0.18
73 0.17
74 0.13
75 0.12
76 0.12
77 0.1
78 0.09
79 0.09
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.05
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.03
95 0.03
96 0.03
97 0.03
98 0.04
99 0.04
100 0.03
101 0.04
102 0.03
103 0.04
104 0.04
105 0.05
106 0.05
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.05
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.03
127 0.04
128 0.03
129 0.04
130 0.04
131 0.04
132 0.06
133 0.06
134 0.07
135 0.09
136 0.09
137 0.09
138 0.1
139 0.14
140 0.12
141 0.13
142 0.14
143 0.15
144 0.17
145 0.19
146 0.22
147 0.24
148 0.26
149 0.3
150 0.3
151 0.29
152 0.28
153 0.3
154 0.27
155 0.23
156 0.26
157 0.23
158 0.23
159 0.24
160 0.24
161 0.21
162 0.22
163 0.28
164 0.25
165 0.26
166 0.27
167 0.26
168 0.26
169 0.25
170 0.3
171 0.3
172 0.27
173 0.3
174 0.31
175 0.35
176 0.44
177 0.5
178 0.45
179 0.44
180 0.53
181 0.52
182 0.54
183 0.51
184 0.46
185 0.41
186 0.44
187 0.4
188 0.31
189 0.28
190 0.26
191 0.23
192 0.22
193 0.22
194 0.16
195 0.17
196 0.2
197 0.19
198 0.24
199 0.28
200 0.33
201 0.39
202 0.43
203 0.44
204 0.43
205 0.44
206 0.42
207 0.42
208 0.34
209 0.28
210 0.24
211 0.23
212 0.23
213 0.21
214 0.17
215 0.13
216 0.12
217 0.11
218 0.11
219 0.1
220 0.09
221 0.1
222 0.11
223 0.11
224 0.11
225 0.12
226 0.15
227 0.16
228 0.17
229 0.18
230 0.22
231 0.23
232 0.26
233 0.33
234 0.37
235 0.44