Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1C3YM73

Protein Details
Accession A0A1C3YM73    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
35-64SIDKVGKKPPPRPRRSKARQTVRIPRYRRIBasic
NLS Segment(s)
PositionSequence
39-60VGKKPPPRPRRSKARQTVRIPR
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MEVESQEDCSSLDDWPYELLSESIPANTARSLIHSIDKVGKKPPPRPRRSKARQTVRIPRYRRIEASVEAHYSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.09
5 0.09
6 0.09
7 0.08
8 0.08
9 0.08
10 0.07
11 0.08
12 0.08
13 0.08
14 0.08
15 0.09
16 0.07
17 0.1
18 0.12
19 0.12
20 0.14
21 0.13
22 0.14
23 0.2
24 0.22
25 0.21
26 0.23
27 0.26
28 0.3
29 0.39
30 0.48
31 0.52
32 0.6
33 0.69
34 0.74
35 0.81
36 0.85
37 0.87
38 0.87
39 0.87
40 0.88
41 0.87
42 0.89
43 0.88
44 0.87
45 0.81
46 0.79
47 0.76
48 0.72
49 0.66
50 0.6
51 0.55
52 0.51
53 0.51
54 0.47