FuNGI

A0A098E0D3

Protein Details

Accession

A0A098E0D3

Localization Confidence

Medium

Confidence Score

13.3

NoLS Segment(s)

Position	Sequence	Protein Nature
344-392	TTRTSDMGPPPKKKRGPKPKPLSERKPLRTTPIVRKENSYSKQKRKEVI	Hydrophilic

NLS Segment(s)

Position	Sequence
352-379	PPPKKKRGPKPKPLSERKPLRTTPIVRK

Subcellular Location(s)

nucl 19.5, cyto_nucl 11, mito 3, pero 3

Family & Domain DBs

Amino Acid Sequences

MAPSEEEDTHMAEVIKIDDASSVDEQPQVAKSPPAAKSPAAEPRTKDQGTQTIQDLPPPPPQAARNVQIAPAPGPHQAPPYPYMPQWPHHPMGYAPHPHMPQYPPHPHQQHPHHPQHPQQMVYAHPHQVPHPQYMAQYPHPQMQQYPYHQWPPHPHMAQAPHQYVSPYMGPHVVGYAPQPGYAPHPGNVPQAARGQHPGHVPQQGNAPPQPGNIPQAGRGQQPGRGPRPANAPPQPVPAPPAGPVSQPGAASQPRNVPQAGNAGQPGNVPPQSPLFTPVGTPRWSPTPTPAPQSVASTPARQSASPTPVPESTASTPAPETVPSTPAPEVSASTPAPEPSSSRTTRTSDMGPPPKKKRGPKPKPLSERKPLRTTPIVRKENSYSKQKRKEVITWMVHHRVSRLGEMVPPSAQDAENHFKIPRSTIAGWKTALLGNGPIPK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.14
2	0.14
3	0.12
4	0.12
5	0.11
6	0.12
7	0.15
8	0.16
9	0.16
10	0.16
11	0.17
12	0.17
13	0.18
14	0.19
15	0.18
16	0.18
17	0.18
18	0.21
19	0.28
20	0.31
21	0.34
22	0.36
23	0.34
24	0.36
25	0.4
26	0.46
27	0.42
28	0.43
29	0.42
30	0.46
31	0.54
32	0.51
33	0.47
34	0.43
35	0.48
36	0.48
37	0.47
38	0.42
39	0.41
40	0.41
41	0.44
42	0.41
43	0.35
44	0.38
45	0.37
46	0.35
47	0.32
48	0.33
49	0.36
50	0.4
51	0.4
52	0.39
53	0.38
54	0.38
55	0.36
56	0.35
57	0.29
58	0.25
59	0.23
60	0.2
61	0.21
62	0.21
63	0.23
64	0.24
65	0.25
66	0.26
67	0.27
68	0.27
69	0.26
70	0.33
71	0.32
72	0.33
73	0.38
74	0.42
75	0.41
76	0.38
77	0.39
78	0.32
79	0.35
80	0.39
81	0.36
82	0.33
83	0.36
84	0.36
85	0.36
86	0.4
87	0.35
88	0.34
89	0.39
90	0.45
91	0.43
92	0.51
93	0.55
94	0.55
95	0.62
96	0.65
97	0.67
98	0.67
99	0.74
100	0.7
101	0.71
102	0.73
103	0.74
104	0.69
105	0.59
106	0.52
107	0.44
108	0.4
109	0.42
110	0.38
111	0.32
112	0.28
113	0.28
114	0.26
115	0.32
116	0.33
117	0.29
118	0.28
119	0.25
120	0.25
121	0.29
122	0.32
123	0.28
124	0.32
125	0.31
126	0.34
127	0.34
128	0.33
129	0.3
130	0.32
131	0.34
132	0.33
133	0.38
134	0.36
135	0.43
136	0.44
137	0.47
138	0.48
139	0.49
140	0.53
141	0.47
142	0.44
143	0.41
144	0.45
145	0.48
146	0.46
147	0.41
148	0.33
149	0.32
150	0.31
151	0.26
152	0.24
153	0.18
154	0.12
155	0.11
156	0.11
157	0.11
158	0.1
159	0.11
160	0.08
161	0.07
162	0.07
163	0.11
164	0.1
165	0.1
166	0.11
167	0.1
168	0.14
169	0.18
170	0.19
171	0.15
172	0.17
173	0.19
174	0.21
175	0.22
176	0.19
177	0.16
178	0.19
179	0.2
180	0.18
181	0.22
182	0.21
183	0.22
184	0.23
185	0.24
186	0.24
187	0.28
188	0.27
189	0.23
190	0.28
191	0.28
192	0.29
193	0.27
194	0.25
195	0.2
196	0.2
197	0.21
198	0.17
199	0.16
200	0.15
201	0.15
202	0.15
203	0.19
204	0.21
205	0.19
206	0.21
207	0.19
208	0.21
209	0.25
210	0.29
211	0.28
212	0.31
213	0.31
214	0.31
215	0.37
216	0.38
217	0.42
218	0.4
219	0.41
220	0.37
221	0.41
222	0.4
223	0.33
224	0.31
225	0.24
226	0.2
227	0.16
228	0.18
229	0.14
230	0.13
231	0.14
232	0.14
233	0.15
234	0.14
235	0.13
236	0.14
237	0.15
238	0.16
239	0.17
240	0.2
241	0.21
242	0.23
243	0.23
244	0.2
245	0.19
246	0.25
247	0.24
248	0.2
249	0.18
250	0.17
251	0.17
252	0.17
253	0.17
254	0.14
255	0.13
256	0.12
257	0.12
258	0.14
259	0.16
260	0.16
261	0.18
262	0.15
263	0.15
264	0.15
265	0.19
266	0.2
267	0.2
268	0.2
269	0.19
270	0.23
271	0.25
272	0.25
273	0.27
274	0.31
275	0.32
276	0.37
277	0.36
278	0.34
279	0.34
280	0.37
281	0.31
282	0.28
283	0.27
284	0.25
285	0.24
286	0.25
287	0.26
288	0.22
289	0.26
290	0.27
291	0.31
292	0.31
293	0.32
294	0.3
295	0.3
296	0.32
297	0.28
298	0.27
299	0.23
300	0.24
301	0.23
302	0.2
303	0.2
304	0.19
305	0.19
306	0.14
307	0.15
308	0.12
309	0.15
310	0.14
311	0.17
312	0.16
313	0.16
314	0.17
315	0.15
316	0.15
317	0.14
318	0.17
319	0.14
320	0.16
321	0.16
322	0.16
323	0.17
324	0.16
325	0.17
326	0.18
327	0.25
328	0.25
329	0.28
330	0.32
331	0.35
332	0.37
333	0.38
334	0.37
335	0.37
336	0.45
337	0.52
338	0.55
339	0.61
340	0.66
341	0.73
342	0.77
343	0.79
344	0.81
345	0.82
346	0.85
347	0.86
348	0.89
349	0.9
350	0.93
351	0.94
352	0.92
353	0.91
354	0.91
355	0.88
356	0.86
357	0.78
358	0.74
359	0.73
360	0.72
361	0.72
362	0.72
363	0.71
364	0.64
365	0.67
366	0.67
367	0.68
368	0.67
369	0.67
370	0.66
371	0.7
372	0.79
373	0.8
374	0.8
375	0.77
376	0.77
377	0.76
378	0.75
379	0.73
380	0.69
381	0.7
382	0.69
383	0.64
384	0.57
385	0.49
386	0.45
387	0.39
388	0.36
389	0.3
390	0.25
391	0.26
392	0.28
393	0.29
394	0.24
395	0.21
396	0.21
397	0.2
398	0.2
399	0.18
400	0.22
401	0.28
402	0.3
403	0.32
404	0.31
405	0.32
406	0.33
407	0.35
408	0.32
409	0.32
410	0.33
411	0.39
412	0.43
413	0.44
414	0.43
415	0.4
416	0.38
417	0.32
418	0.29
419	0.22
420	0.2

A0A098E0D3

3D AlphaFold-predicted Structure Viewer