Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C3YMV2

Protein Details
Accession A0A1C3YMV2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
338-364LSPIKMLEPKPERRPERKPPGPAWKDYHydrophilic
NLS Segment(s)
PositionSequence
347-357KPERRPERKPP
Subcellular Location(s) plas 20, E.R. 3, mito 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTLTKTFPPPKGQTVIGVSFTLIAFAAAIIGFRIYHRLRIQKGRLVLSDYFMILALCGAITCASFDVVFWQRDVLRPRMSVGFENYNPGEELVEFIYKLSWASEIPFYATVYLCKAILLALYFQIFPPFMGRRRRALWATVFYCGLAYTITLCMQLFSCMPLERHWVISRPITACDWRWQGVVFQVSWALAFLGSLLVLILPFMVVHDLDLTKRSKFCLYFVSLVGVLDIGISLIRFLNVELGDGTEFRSFSTIEFWSALDVNIGLITACLPALRILLGRTRTPDTYTFDEAKTARSSRAMEHRELEEVQDSTYLGISNTAGPSRSNRASMYSDKGPLSPIKMLEPKPERRPERKPPGPAWKDYEGEDSDLELENINVEALNRDQAQSYWSVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.48
3 0.41
4 0.35
5 0.28
6 0.25
7 0.23
8 0.18
9 0.12
10 0.08
11 0.06
12 0.06
13 0.06
14 0.04
15 0.05
16 0.04
17 0.05
18 0.05
19 0.06
20 0.14
21 0.14
22 0.22
23 0.29
24 0.37
25 0.44
26 0.54
27 0.6
28 0.59
29 0.64
30 0.62
31 0.58
32 0.55
33 0.48
34 0.41
35 0.35
36 0.29
37 0.23
38 0.18
39 0.15
40 0.1
41 0.09
42 0.06
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.06
51 0.06
52 0.06
53 0.12
54 0.17
55 0.17
56 0.17
57 0.19
58 0.2
59 0.26
60 0.31
61 0.31
62 0.3
63 0.3
64 0.33
65 0.35
66 0.36
67 0.33
68 0.33
69 0.35
70 0.3
71 0.35
72 0.32
73 0.29
74 0.27
75 0.24
76 0.19
77 0.12
78 0.13
79 0.1
80 0.1
81 0.09
82 0.09
83 0.09
84 0.08
85 0.08
86 0.07
87 0.06
88 0.06
89 0.08
90 0.1
91 0.1
92 0.12
93 0.13
94 0.13
95 0.13
96 0.13
97 0.12
98 0.12
99 0.12
100 0.1
101 0.09
102 0.09
103 0.08
104 0.08
105 0.08
106 0.07
107 0.07
108 0.08
109 0.08
110 0.08
111 0.09
112 0.09
113 0.08
114 0.12
115 0.14
116 0.2
117 0.29
118 0.32
119 0.36
120 0.39
121 0.45
122 0.43
123 0.44
124 0.43
125 0.41
126 0.4
127 0.36
128 0.33
129 0.27
130 0.25
131 0.2
132 0.15
133 0.07
134 0.05
135 0.05
136 0.06
137 0.06
138 0.07
139 0.06
140 0.07
141 0.07
142 0.08
143 0.07
144 0.07
145 0.08
146 0.09
147 0.1
148 0.11
149 0.16
150 0.16
151 0.19
152 0.19
153 0.2
154 0.21
155 0.23
156 0.25
157 0.2
158 0.21
159 0.2
160 0.21
161 0.2
162 0.23
163 0.24
164 0.21
165 0.2
166 0.19
167 0.18
168 0.19
169 0.19
170 0.13
171 0.11
172 0.1
173 0.1
174 0.09
175 0.08
176 0.05
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.02
183 0.02
184 0.02
185 0.02
186 0.02
187 0.02
188 0.02
189 0.02
190 0.02
191 0.02
192 0.02
193 0.03
194 0.04
195 0.04
196 0.05
197 0.08
198 0.1
199 0.11
200 0.11
201 0.13
202 0.16
203 0.16
204 0.18
205 0.2
206 0.22
207 0.23
208 0.23
209 0.23
210 0.19
211 0.18
212 0.16
213 0.11
214 0.07
215 0.05
216 0.04
217 0.02
218 0.02
219 0.02
220 0.03
221 0.03
222 0.03
223 0.03
224 0.03
225 0.07
226 0.07
227 0.07
228 0.07
229 0.08
230 0.08
231 0.08
232 0.1
233 0.08
234 0.08
235 0.07
236 0.08
237 0.08
238 0.08
239 0.12
240 0.11
241 0.11
242 0.12
243 0.11
244 0.12
245 0.12
246 0.11
247 0.08
248 0.07
249 0.06
250 0.05
251 0.05
252 0.04
253 0.03
254 0.03
255 0.03
256 0.03
257 0.03
258 0.04
259 0.04
260 0.05
261 0.05
262 0.06
263 0.07
264 0.12
265 0.15
266 0.16
267 0.2
268 0.23
269 0.23
270 0.26
271 0.29
272 0.29
273 0.32
274 0.35
275 0.34
276 0.31
277 0.34
278 0.31
279 0.31
280 0.3
281 0.26
282 0.23
283 0.24
284 0.25
285 0.26
286 0.36
287 0.37
288 0.36
289 0.38
290 0.38
291 0.37
292 0.36
293 0.32
294 0.25
295 0.21
296 0.18
297 0.15
298 0.14
299 0.11
300 0.11
301 0.1
302 0.07
303 0.07
304 0.07
305 0.09
306 0.11
307 0.11
308 0.12
309 0.12
310 0.17
311 0.23
312 0.25
313 0.25
314 0.25
315 0.29
316 0.33
317 0.37
318 0.39
319 0.36
320 0.38
321 0.37
322 0.36
323 0.35
324 0.32
325 0.31
326 0.28
327 0.25
328 0.28
329 0.35
330 0.36
331 0.43
332 0.49
333 0.54
334 0.6
335 0.69
336 0.71
337 0.73
338 0.81
339 0.82
340 0.84
341 0.85
342 0.84
343 0.83
344 0.85
345 0.83
346 0.79
347 0.75
348 0.69
349 0.62
350 0.56
351 0.52
352 0.43
353 0.39
354 0.32
355 0.26
356 0.22
357 0.21
358 0.19
359 0.13
360 0.11
361 0.09
362 0.09
363 0.08
364 0.07
365 0.06
366 0.09
367 0.1
368 0.14
369 0.15
370 0.16
371 0.17
372 0.17
373 0.19