Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RWC0

Protein Details
Accession I1RWC0    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
153-173NHGKVEQKCKGQKTKERIWPCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12cyto_nucl 12, mito 8, nucl 6
Family & Domain DBs
KEGG fgr:FGSG_08584  -  
Amino Acid Sequences MGRLGKGCNPRTGLQIVIDWCPECKDGFAKVIQGLKQVVPTGYHNLWDYRLLSRYWAIKSQSRCSKAVDADPIGYQAFASDQEIKYIPFDQFNADGEREDGFWELQALENEVRRLQPDFAWIKGDPQGARLKLSDQLSLCASAIEVTELKAWNHGKVEQKCKGQKTKERIWPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.28
4 0.26
5 0.26
6 0.21
7 0.2
8 0.2
9 0.19
10 0.15
11 0.15
12 0.16
13 0.17
14 0.2
15 0.2
16 0.21
17 0.23
18 0.27
19 0.26
20 0.26
21 0.25
22 0.23
23 0.23
24 0.22
25 0.19
26 0.17
27 0.18
28 0.21
29 0.2
30 0.21
31 0.21
32 0.2
33 0.21
34 0.21
35 0.2
36 0.17
37 0.18
38 0.16
39 0.17
40 0.19
41 0.22
42 0.22
43 0.25
44 0.26
45 0.29
46 0.34
47 0.41
48 0.47
49 0.46
50 0.45
51 0.44
52 0.45
53 0.42
54 0.41
55 0.36
56 0.28
57 0.25
58 0.24
59 0.22
60 0.17
61 0.14
62 0.11
63 0.06
64 0.06
65 0.05
66 0.07
67 0.09
68 0.09
69 0.1
70 0.11
71 0.11
72 0.12
73 0.13
74 0.11
75 0.09
76 0.09
77 0.1
78 0.1
79 0.11
80 0.13
81 0.12
82 0.11
83 0.11
84 0.11
85 0.1
86 0.09
87 0.09
88 0.06
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.09
95 0.09
96 0.11
97 0.11
98 0.12
99 0.12
100 0.12
101 0.13
102 0.12
103 0.12
104 0.18
105 0.19
106 0.19
107 0.23
108 0.22
109 0.22
110 0.25
111 0.28
112 0.2
113 0.22
114 0.28
115 0.25
116 0.27
117 0.26
118 0.23
119 0.25
120 0.27
121 0.27
122 0.21
123 0.23
124 0.22
125 0.22
126 0.21
127 0.15
128 0.13
129 0.1
130 0.09
131 0.09
132 0.08
133 0.08
134 0.11
135 0.12
136 0.13
137 0.19
138 0.2
139 0.21
140 0.24
141 0.28
142 0.35
143 0.42
144 0.52
145 0.53
146 0.61
147 0.66
148 0.73
149 0.78
150 0.78
151 0.8
152 0.79
153 0.82