Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5QYS4

Protein Details
Accession E5QYS4   
Localization Confidence High
Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
56-99GSSRGERRVRSRSRSRDRGERRRDRSWSRDRRPRDYPRDTRRDSBasic
118-137YSSRRDYTSRSKRHRERSFSHydrophilic
235-258NNVSGVRKEKKTQYRQYMNRVGGFHydrophilic
NLS Segment(s)
PositionSequence
58-173SRGERRVRSRSRSRDRGERRRDRSWSRDRRPRDYPRDTRRDSDRDGRGVKGRERSLSRERYSSRRDYTSRSKRHRERSFSRSPSRSRSPARNGRRARSRSPARRGGLDRADTKHSR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MPDTMVEPPAKRARRTDSSAMWDMNDNSTRSDGESKESSGTLRKPATGSEEVSRNGSSRGERRVRSRSRSRDRGERRRDRSWSRDRRPRDYPRDTRRDSDRDGRGVKGRERSLSRERYSSRRDYTSRSKRHRERSFSRSPSRSRSPARNGRRARSRSPARRGGLDRADTKHSRHGEPSREPNGVASSARPPTKSGRQDEMEVDIPDDPDDLDQVMMKAMGFSSFKSTQNTKVPGNNVSGVRKEKKTQYRQYMNRVGGFNKPLSPTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.64
4 0.61
5 0.63
6 0.64
7 0.58
8 0.5
9 0.46
10 0.4
11 0.38
12 0.35
13 0.28
14 0.24
15 0.25
16 0.24
17 0.24
18 0.28
19 0.23
20 0.24
21 0.26
22 0.26
23 0.26
24 0.26
25 0.25
26 0.26
27 0.28
28 0.29
29 0.28
30 0.29
31 0.27
32 0.29
33 0.34
34 0.31
35 0.31
36 0.29
37 0.32
38 0.31
39 0.32
40 0.31
41 0.25
42 0.23
43 0.23
44 0.23
45 0.24
46 0.33
47 0.38
48 0.41
49 0.48
50 0.57
51 0.63
52 0.67
53 0.72
54 0.74
55 0.77
56 0.83
57 0.81
58 0.82
59 0.84
60 0.86
61 0.86
62 0.86
63 0.83
64 0.81
65 0.84
66 0.81
67 0.8
68 0.8
69 0.8
70 0.8
71 0.82
72 0.8
73 0.79
74 0.81
75 0.82
76 0.81
77 0.8
78 0.8
79 0.81
80 0.84
81 0.8
82 0.75
83 0.72
84 0.67
85 0.62
86 0.61
87 0.55
88 0.51
89 0.5
90 0.47
91 0.45
92 0.44
93 0.43
94 0.41
95 0.38
96 0.37
97 0.38
98 0.42
99 0.45
100 0.49
101 0.47
102 0.46
103 0.47
104 0.49
105 0.52
106 0.53
107 0.48
108 0.46
109 0.46
110 0.46
111 0.54
112 0.57
113 0.61
114 0.62
115 0.68
116 0.71
117 0.8
118 0.82
119 0.8
120 0.77
121 0.75
122 0.77
123 0.75
124 0.74
125 0.69
126 0.65
127 0.63
128 0.61
129 0.6
130 0.55
131 0.56
132 0.58
133 0.62
134 0.66
135 0.69
136 0.68
137 0.69
138 0.74
139 0.7
140 0.66
141 0.66
142 0.68
143 0.68
144 0.71
145 0.72
146 0.64
147 0.65
148 0.63
149 0.6
150 0.55
151 0.5
152 0.45
153 0.39
154 0.44
155 0.39
156 0.38
157 0.39
158 0.36
159 0.34
160 0.38
161 0.41
162 0.43
163 0.48
164 0.55
165 0.52
166 0.49
167 0.47
168 0.41
169 0.37
170 0.31
171 0.24
172 0.17
173 0.17
174 0.21
175 0.23
176 0.22
177 0.23
178 0.28
179 0.37
180 0.43
181 0.44
182 0.46
183 0.47
184 0.49
185 0.48
186 0.46
187 0.4
188 0.32
189 0.28
190 0.21
191 0.19
192 0.16
193 0.15
194 0.1
195 0.07
196 0.07
197 0.06
198 0.06
199 0.06
200 0.06
201 0.06
202 0.06
203 0.06
204 0.06
205 0.05
206 0.08
207 0.08
208 0.09
209 0.16
210 0.19
211 0.22
212 0.27
213 0.3
214 0.35
215 0.43
216 0.47
217 0.44
218 0.47
219 0.48
220 0.46
221 0.48
222 0.45
223 0.41
224 0.41
225 0.42
226 0.44
227 0.47
228 0.49
229 0.51
230 0.56
231 0.62
232 0.69
233 0.73
234 0.77
235 0.81
236 0.84
237 0.88
238 0.87
239 0.82
240 0.77
241 0.7
242 0.61
243 0.57
244 0.53
245 0.46
246 0.41