Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A098DBB6

Protein Details
Accession A0A098DBB6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-98SGPTEGKKKINARRVSRYKIVRRHydrophilic
NLS Segment(s)
PositionSequence
82-98KKKINARRVSRYKIVRR
Subcellular Location(s) nucl 10.5mito_nucl 10.5, mito 9.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MIIAQDQGHWLTASFTRGRESQTTKAKLTVLWGAINSPKPWYDVSLHETGMRMHGFTCRSAVHLWLYLENENEKFSGPTEGKKKINARRVSRYKIVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.2
4 0.21
5 0.24
6 0.29
7 0.33
8 0.37
9 0.45
10 0.49
11 0.46
12 0.48
13 0.44
14 0.38
15 0.35
16 0.3
17 0.22
18 0.18
19 0.17
20 0.16
21 0.18
22 0.2
23 0.17
24 0.15
25 0.14
26 0.14
27 0.15
28 0.16
29 0.15
30 0.16
31 0.2
32 0.21
33 0.21
34 0.2
35 0.2
36 0.17
37 0.17
38 0.14
39 0.09
40 0.08
41 0.1
42 0.11
43 0.11
44 0.13
45 0.11
46 0.12
47 0.13
48 0.14
49 0.13
50 0.15
51 0.15
52 0.15
53 0.17
54 0.16
55 0.17
56 0.17
57 0.16
58 0.14
59 0.14
60 0.13
61 0.11
62 0.11
63 0.17
64 0.17
65 0.23
66 0.3
67 0.37
68 0.38
69 0.46
70 0.54
71 0.56
72 0.65
73 0.67
74 0.69
75 0.73
76 0.8
77 0.8
78 0.81