Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S4W9

Protein Details
Accession I1S4W9   
Localization Confidence Low
Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-76FIDHKGQRWRREEKRRWKCIAKVBasic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 11.5, cyto 3.5, nucl 2, plas 2
Family & Domain DBs
KEGG fgr:FGSG_11887  -  
Amino Acid Sequences MHGRLVLGKLPCDAVRCSHGRYDMASLVFVSVLHKLILSRPGYGSTIAMLRHGFIDHKGQRWRREEKRRWKCIAKVLMQDWAMQADRILGTRQKENRRNGINKWKLGFNGGRLQAYEASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.27
4 0.29
5 0.3
6 0.32
7 0.3
8 0.3
9 0.31
10 0.29
11 0.26
12 0.24
13 0.19
14 0.16
15 0.15
16 0.13
17 0.1
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.09
24 0.16
25 0.16
26 0.16
27 0.16
28 0.17
29 0.18
30 0.18
31 0.16
32 0.11
33 0.12
34 0.1
35 0.11
36 0.09
37 0.09
38 0.09
39 0.09
40 0.08
41 0.08
42 0.16
43 0.17
44 0.23
45 0.3
46 0.34
47 0.41
48 0.47
49 0.55
50 0.56
51 0.65
52 0.7
53 0.74
54 0.8
55 0.82
56 0.83
57 0.8
58 0.75
59 0.73
60 0.71
61 0.65
62 0.6
63 0.52
64 0.51
65 0.45
66 0.4
67 0.31
68 0.25
69 0.2
70 0.14
71 0.13
72 0.09
73 0.09
74 0.09
75 0.11
76 0.13
77 0.15
78 0.23
79 0.31
80 0.41
81 0.49
82 0.55
83 0.62
84 0.69
85 0.72
86 0.73
87 0.76
88 0.74
89 0.72
90 0.68
91 0.62
92 0.54
93 0.55
94 0.49
95 0.43
96 0.43
97 0.4
98 0.39
99 0.35
100 0.37