Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1SAD2

Protein Details
Accession I1SAD2    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-49LRVPSDESTRRPKRKKFNNIRKMIPGHydrophilic
NLS Segment(s)
PositionSequence
33-53RRPKRKKFNNIRKMIPGVRKK
Subcellular Location(s) mito 16, mito_nucl 11.999, cyto_mito 10.999, cyto_nucl 6.666, nucl 6.5
Family & Domain DBs
KEGG fgr:FGSG_13813  -  
Amino Acid Sequences MSNRHVPTRRLKSGVLFSAPDDILRVPSDESTRRPKRKKFNNIRKMIPGVRKKGVGEEMALDASPALGHQESIAMFAKFVDPSSYGSSNHPNNPPVSSQKKETLCLSVLKVSLTATVEGTLAHMVLKQSFYNPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.51
3 0.41
4 0.35
5 0.36
6 0.33
7 0.27
8 0.21
9 0.16
10 0.15
11 0.14
12 0.15
13 0.11
14 0.13
15 0.18
16 0.2
17 0.24
18 0.33
19 0.43
20 0.52
21 0.6
22 0.67
23 0.74
24 0.81
25 0.88
26 0.88
27 0.9
28 0.9
29 0.88
30 0.84
31 0.78
32 0.73
33 0.68
34 0.66
35 0.62
36 0.57
37 0.52
38 0.49
39 0.44
40 0.42
41 0.38
42 0.29
43 0.22
44 0.18
45 0.15
46 0.13
47 0.13
48 0.09
49 0.06
50 0.05
51 0.05
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.05
59 0.07
60 0.09
61 0.08
62 0.08
63 0.08
64 0.09
65 0.08
66 0.08
67 0.08
68 0.07
69 0.1
70 0.15
71 0.16
72 0.16
73 0.19
74 0.25
75 0.28
76 0.32
77 0.33
78 0.31
79 0.3
80 0.31
81 0.32
82 0.33
83 0.37
84 0.35
85 0.36
86 0.42
87 0.43
88 0.44
89 0.43
90 0.39
91 0.33
92 0.33
93 0.31
94 0.26
95 0.24
96 0.22
97 0.2
98 0.17
99 0.17
100 0.16
101 0.14
102 0.11
103 0.11
104 0.11
105 0.1
106 0.11
107 0.09
108 0.07
109 0.07
110 0.08
111 0.08
112 0.1
113 0.13
114 0.12