Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A098CZI6

Protein Details
Accession A0A098CZI6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-31TSEPTQQKWKIKCTKCKRIVNTGKCSFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MADTTSEPTQQKWKIKCTKCKRIVNTGKCSFCSKINQKIDWIRLRCTARDIFEASVGSIRSLPKMAFIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.68
3 0.77
4 0.78
5 0.82
6 0.84
7 0.88
8 0.83
9 0.84
10 0.85
11 0.83
12 0.82
13 0.79
14 0.71
15 0.63
16 0.61
17 0.51
18 0.44
19 0.44
20 0.4
21 0.42
22 0.45
23 0.44
24 0.45
25 0.49
26 0.52
27 0.51
28 0.48
29 0.41
30 0.43
31 0.44
32 0.4
33 0.4
34 0.36
35 0.31
36 0.32
37 0.32
38 0.26
39 0.25
40 0.25
41 0.2
42 0.19
43 0.17
44 0.14
45 0.14
46 0.14
47 0.14
48 0.16
49 0.15