Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RKY0

Protein Details
Accession I1RKY0   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-70VENPRKKPKHSRPSKSGSARBasic
NLS Segment(s)
PositionSequence
55-70RKKPKHSRPSKSGSAR
105-117SVSSRSKGKGKAK
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG fgr:FGSG_04552  -  
Amino Acid Sequences MMMTGDSSGGGSGSGGTVLSTKRKRPNAGKSASIDGAANQDNGDHDDPVDVENPRKKPKHSRPSKSGSARAPTAPSNGATTVGRMTRSTRSAPSKPNTAASKYKSVSSRSKGKGKAKAPLSSMTVDPEDDDKDEDGGQASEYQKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.06
5 0.08
6 0.18
7 0.23
8 0.3
9 0.4
10 0.47
11 0.56
12 0.64
13 0.73
14 0.74
15 0.74
16 0.72
17 0.67
18 0.64
19 0.56
20 0.47
21 0.36
22 0.26
23 0.25
24 0.19
25 0.16
26 0.11
27 0.1
28 0.1
29 0.14
30 0.14
31 0.11
32 0.1
33 0.1
34 0.1
35 0.11
36 0.13
37 0.1
38 0.14
39 0.2
40 0.24
41 0.32
42 0.35
43 0.38
44 0.47
45 0.58
46 0.64
47 0.69
48 0.74
49 0.74
50 0.78
51 0.83
52 0.77
53 0.72
54 0.65
55 0.58
56 0.51
57 0.43
58 0.38
59 0.29
60 0.25
61 0.2
62 0.16
63 0.14
64 0.12
65 0.13
66 0.11
67 0.1
68 0.11
69 0.11
70 0.11
71 0.1
72 0.13
73 0.15
74 0.18
75 0.2
76 0.24
77 0.31
78 0.35
79 0.42
80 0.43
81 0.46
82 0.44
83 0.49
84 0.46
85 0.44
86 0.46
87 0.42
88 0.46
89 0.41
90 0.44
91 0.41
92 0.44
93 0.47
94 0.47
95 0.53
96 0.51
97 0.59
98 0.63
99 0.67
100 0.71
101 0.67
102 0.7
103 0.66
104 0.64
105 0.59
106 0.54
107 0.49
108 0.42
109 0.38
110 0.33
111 0.28
112 0.22
113 0.21
114 0.19
115 0.17
116 0.16
117 0.17
118 0.15
119 0.15
120 0.15
121 0.14
122 0.14
123 0.12
124 0.12
125 0.15