Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A098DNU7

Protein Details
Accession A0A098DNU7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
115-148DRLLKPSQTGQDRRRRRSRLRRRTGRQNYSPGCLHydrophilic
NLS Segment(s)
PositionSequence
127-139RRRRRSRLRRRTG
Subcellular Location(s) plas 11, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MDVHMHHGQWARHIHKDPPDWRWVAPHDRAAVDGQVVWAPLQVSKDPGEDLVVDEFVTDATGGAAVDEKVAGGELAVAAEGGIGAAVVVVVRMGGEEGVGADAEPVRDGDNPDRDRLLKPSQTGQDRRRRRSRLRRRTGRQNYSPGCLFLEKSRRYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.6
4 0.6
5 0.56
6 0.59
7 0.54
8 0.51
9 0.51
10 0.49
11 0.47
12 0.46
13 0.45
14 0.4
15 0.38
16 0.39
17 0.34
18 0.29
19 0.21
20 0.17
21 0.12
22 0.1
23 0.1
24 0.08
25 0.08
26 0.07
27 0.08
28 0.1
29 0.1
30 0.11
31 0.12
32 0.13
33 0.13
34 0.13
35 0.12
36 0.1
37 0.11
38 0.1
39 0.09
40 0.07
41 0.07
42 0.07
43 0.05
44 0.05
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.01
70 0.01
71 0.01
72 0.01
73 0.01
74 0.01
75 0.01
76 0.01
77 0.01
78 0.01
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.05
94 0.07
95 0.1
96 0.15
97 0.24
98 0.25
99 0.27
100 0.29
101 0.3
102 0.31
103 0.33
104 0.36
105 0.31
106 0.32
107 0.37
108 0.42
109 0.49
110 0.56
111 0.6
112 0.63
113 0.69
114 0.77
115 0.8
116 0.82
117 0.84
118 0.87
119 0.89
120 0.9
121 0.92
122 0.93
123 0.92
124 0.94
125 0.94
126 0.93
127 0.9
128 0.9
129 0.82
130 0.77
131 0.7
132 0.6
133 0.52
134 0.43
135 0.37
136 0.35
137 0.41