Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1REC0

Protein Details
Accession I1REC0   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-41KNRLAARASKARKDRRKKSQAPKDKVAKADBasic
NLS Segment(s)
PositionSequence
15-79LAARASKARKDRRKKSQAPKDKVAKADTTRGARKGLLPTSGPRAKMSAKKARKVEKAMAHAMKRK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
KEGG fgr:FGSG_02007  -  
Amino Acid Sequences MPSVGNPNGPCKNRLAARASKARKDRRKKSQAPKDKVAKADTTRGARKGLLPTSGPRAKMSAKKARKVEKAMAHAMKRKMEADGEAEMKDAPEAETEEKTEEAEMADIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.46
3 0.45
4 0.5
5 0.59
6 0.61
7 0.62
8 0.67
9 0.72
10 0.76
11 0.79
12 0.82
13 0.83
14 0.88
15 0.9
16 0.92
17 0.92
18 0.93
19 0.9
20 0.89
21 0.87
22 0.81
23 0.74
24 0.66
25 0.6
26 0.52
27 0.5
28 0.46
29 0.42
30 0.41
31 0.38
32 0.37
33 0.32
34 0.32
35 0.3
36 0.26
37 0.23
38 0.2
39 0.2
40 0.27
41 0.29
42 0.26
43 0.22
44 0.22
45 0.24
46 0.29
47 0.35
48 0.38
49 0.42
50 0.49
51 0.55
52 0.62
53 0.65
54 0.64
55 0.64
56 0.61
57 0.59
58 0.6
59 0.59
60 0.54
61 0.54
62 0.53
63 0.47
64 0.42
65 0.38
66 0.32
67 0.27
68 0.24
69 0.21
70 0.21
71 0.2
72 0.18
73 0.18
74 0.16
75 0.15
76 0.13
77 0.11
78 0.07
79 0.07
80 0.1
81 0.12
82 0.14
83 0.15
84 0.17
85 0.17
86 0.17
87 0.16
88 0.13
89 0.11