Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1RJM7

Protein Details
Accession I1RJM7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-25REGGKVKPLKQAKKAQKDLDBasic
NLS Segment(s)
PositionSequence
34-68KKRADEKARKELAAKAGGKGPLNTGGQGIKKSGKK
Subcellular Location(s) nucl 18, mito 5, pero 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
KEGG fgr:FGSG_04052  -  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MGGANREGGKVKPLKQAKKAQKDLDEDDMAFLEKKRADEKARKELAAKAGGKGPLNTGGQGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.7
4 0.72
5 0.77
6 0.8
7 0.77
8 0.74
9 0.72
10 0.67
11 0.62
12 0.53
13 0.42
14 0.34
15 0.28
16 0.21
17 0.16
18 0.13
19 0.1
20 0.09
21 0.11
22 0.12
23 0.16
24 0.22
25 0.3
26 0.37
27 0.45
28 0.47
29 0.46
30 0.47
31 0.46
32 0.46
33 0.45
34 0.39
35 0.3
36 0.31
37 0.33
38 0.32
39 0.29
40 0.25
41 0.23
42 0.23
43 0.22
44 0.2
45 0.21
46 0.23
47 0.24
48 0.25