Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4USD9

Protein Details
Accession E4USD9   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-52PEGKASQSPEKRRLCKKRRRGCAQAFGKGHydrophilic
116-135ALCLCLRLRGGRKKQQRRPKHydrophilic
NLS Segment(s)
PositionSequence
35-42RRLCKKRR
124-135RGGRKKQQRRPK
Subcellular Location(s) nucl 14, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MTSSIRPFQEQPICLPNPYSIEIPEGKASQSPEKRRLCKKRRRGCAQAFGKGGQRDLVVVIVASEGELSWIECNSAKARVAMEKEGHLALPPPCLTSIKIAQLKTVWRWDSLLACALCLCLRLRGGRKKQQRRPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.33
4 0.29
5 0.3
6 0.27
7 0.2
8 0.22
9 0.22
10 0.23
11 0.23
12 0.2
13 0.18
14 0.19
15 0.22
16 0.27
17 0.35
18 0.4
19 0.47
20 0.55
21 0.63
22 0.71
23 0.79
24 0.8
25 0.83
26 0.86
27 0.87
28 0.89
29 0.9
30 0.89
31 0.87
32 0.86
33 0.82
34 0.77
35 0.69
36 0.6
37 0.56
38 0.46
39 0.38
40 0.28
41 0.22
42 0.15
43 0.13
44 0.12
45 0.06
46 0.05
47 0.05
48 0.04
49 0.03
50 0.03
51 0.03
52 0.02
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.05
60 0.06
61 0.07
62 0.09
63 0.09
64 0.1
65 0.11
66 0.14
67 0.16
68 0.18
69 0.18
70 0.17
71 0.18
72 0.17
73 0.16
74 0.13
75 0.14
76 0.11
77 0.13
78 0.13
79 0.12
80 0.13
81 0.14
82 0.15
83 0.17
84 0.2
85 0.24
86 0.29
87 0.28
88 0.29
89 0.31
90 0.34
91 0.33
92 0.38
93 0.31
94 0.27
95 0.28
96 0.29
97 0.28
98 0.26
99 0.29
100 0.21
101 0.2
102 0.19
103 0.18
104 0.16
105 0.16
106 0.15
107 0.12
108 0.14
109 0.22
110 0.31
111 0.41
112 0.51
113 0.6
114 0.7
115 0.78