Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S647

Protein Details
Accession I1S647    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
70-95WQRNYIKMKGMKKRKQPKVSCLWRALHydrophilic
NLS Segment(s)
PositionSequence
78-84KGMKKRK
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito_nucl 11.833, cyto 3.5
Family & Domain DBs
KEGG fgr:FGSG_12318  -  
Amino Acid Sequences MDDIQCRLYQCIRRRDSCIDNTNDRPKKKEEGYVVPNGMSNNLQEPSFYEKGPFRRSDPETYTKSRNGIWQRNYIKMKGMKKRKQPKVSCLWRALGGIDRWTPPLSHQASRNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.65
3 0.66
4 0.66
5 0.66
6 0.62
7 0.62
8 0.65
9 0.7
10 0.7
11 0.65
12 0.6
13 0.56
14 0.58
15 0.54
16 0.54
17 0.49
18 0.51
19 0.54
20 0.56
21 0.52
22 0.44
23 0.42
24 0.34
25 0.29
26 0.2
27 0.15
28 0.11
29 0.11
30 0.11
31 0.09
32 0.11
33 0.18
34 0.18
35 0.18
36 0.18
37 0.21
38 0.26
39 0.31
40 0.31
41 0.26
42 0.32
43 0.35
44 0.39
45 0.4
46 0.41
47 0.42
48 0.44
49 0.45
50 0.4
51 0.38
52 0.33
53 0.36
54 0.38
55 0.41
56 0.41
57 0.47
58 0.48
59 0.56
60 0.57
61 0.51
62 0.49
63 0.48
64 0.52
65 0.53
66 0.61
67 0.6
68 0.69
69 0.79
70 0.82
71 0.86
72 0.85
73 0.84
74 0.84
75 0.86
76 0.83
77 0.77
78 0.69
79 0.6
80 0.53
81 0.45
82 0.4
83 0.31
84 0.27
85 0.25
86 0.24
87 0.24
88 0.25
89 0.24
90 0.2
91 0.28
92 0.29
93 0.32