Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A098D5R1

Protein Details
Accession A0A098D5R1    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-31AALYGRMYKRKKVKKGECNCRGYVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, mito_nucl 12.333, cyto_mito 11.833, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039567  Gly-zipper  
Pfam View protein in Pfam  
PF13488  Gly-zipper_Omp  
Amino Acid Sequences MRNKLCTAALYGRMYKRKKVKKGECNCRGYVGSYVGSYVGIYVGSYVGSYVGSYVGGYVGSYVGSYVGGYDGRYAGRNLSWHASWLNTAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.59
4 0.63
5 0.69
6 0.74
7 0.78
8 0.8
9 0.88
10 0.91
11 0.9
12 0.86
13 0.77
14 0.7
15 0.6
16 0.5
17 0.42
18 0.33
19 0.24
20 0.17
21 0.16
22 0.13
23 0.12
24 0.09
25 0.07
26 0.04
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.04
55 0.05
56 0.05
57 0.06
58 0.07
59 0.08
60 0.1
61 0.1
62 0.11
63 0.13
64 0.15
65 0.18
66 0.22
67 0.21
68 0.22
69 0.23
70 0.22