Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S7S8

Protein Details
Accession I1S7S8    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKRNRSRKRNSPGKARTSDPBasic
NLS Segment(s)
PositionSequence
3-14RNRSRKRNSPGK
Subcellular Location(s) mito 12, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
KEGG fgr:FGSG_12903  -  
Amino Acid Sequences MKRNRSRKRNSPGKARTSDPRQVSLDQWLEDNADSQGANSGIVFRQEQAVRQSCTKSEVLQLRRSSTKYLTRRSTPHSQLYKATLANLEGQIAVRVFDAAVYRAEYEQKAIPHKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.76
3 0.75
4 0.72
5 0.72
6 0.64
7 0.6
8 0.53
9 0.51
10 0.47
11 0.45
12 0.4
13 0.32
14 0.29
15 0.24
16 0.21
17 0.19
18 0.18
19 0.11
20 0.09
21 0.08
22 0.07
23 0.09
24 0.08
25 0.07
26 0.06
27 0.07
28 0.07
29 0.09
30 0.09
31 0.07
32 0.11
33 0.12
34 0.14
35 0.19
36 0.23
37 0.23
38 0.25
39 0.26
40 0.22
41 0.25
42 0.23
43 0.18
44 0.2
45 0.25
46 0.27
47 0.33
48 0.34
49 0.33
50 0.36
51 0.36
52 0.33
53 0.31
54 0.37
55 0.37
56 0.44
57 0.46
58 0.48
59 0.51
60 0.55
61 0.6
62 0.56
63 0.58
64 0.55
65 0.52
66 0.5
67 0.5
68 0.47
69 0.37
70 0.33
71 0.25
72 0.21
73 0.21
74 0.18
75 0.15
76 0.11
77 0.11
78 0.12
79 0.1
80 0.1
81 0.07
82 0.07
83 0.06
84 0.07
85 0.08
86 0.08
87 0.09
88 0.11
89 0.12
90 0.13
91 0.16
92 0.16
93 0.17
94 0.2
95 0.24