Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RLP1

Protein Details
Accession I1RLP1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-33HQRRVLFEKCKIRRTRPKVCTLPWHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, mito 6, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002379  ATPase_proteolipid_c-like_dom  
IPR000245  ATPase_proteolipid_csu  
IPR011555  ATPase_proteolipid_su_C_euk  
IPR035921  F/V-ATP_Csub_sf  
Gene Ontology GO:0033179  C:proton-transporting V-type ATPase, V0 domain  
GO:0005774  C:vacuolar membrane  
GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
KEGG fgr:FGSG_04854  -  
Pfam View protein in Pfam  
PF00137  ATP-synt_C  
CDD cd18176  ATP-synt_Vo_c_ATP6C_rpt2  
Amino Acid Sequences MHTPQNQAAHQRRVLFEKCKIRRTRPKVCTLPWYGIGAAYRTAKSGISIIGVSTFQPDIVLRCIIPVIMSRIIAVYSLVIAVLIADDLDPSKTYTLFSGVLHLASGLTVGLTGIAAGYCIGIVGDAGVRAFMEQPKVYTGMVLILIFAEVLGLYGLIVAILLNQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.53
3 0.54
4 0.57
5 0.6
6 0.65
7 0.71
8 0.74
9 0.79
10 0.82
11 0.84
12 0.81
13 0.84
14 0.83
15 0.79
16 0.77
17 0.71
18 0.66
19 0.57
20 0.51
21 0.41
22 0.34
23 0.3
24 0.22
25 0.2
26 0.18
27 0.16
28 0.14
29 0.15
30 0.13
31 0.13
32 0.13
33 0.1
34 0.09
35 0.09
36 0.08
37 0.08
38 0.09
39 0.08
40 0.08
41 0.08
42 0.06
43 0.07
44 0.07
45 0.08
46 0.1
47 0.1
48 0.08
49 0.09
50 0.09
51 0.08
52 0.08
53 0.08
54 0.09
55 0.09
56 0.1
57 0.09
58 0.1
59 0.1
60 0.09
61 0.08
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.02
75 0.03
76 0.04
77 0.04
78 0.05
79 0.05
80 0.06
81 0.06
82 0.08
83 0.09
84 0.09
85 0.11
86 0.1
87 0.1
88 0.1
89 0.09
90 0.07
91 0.06
92 0.06
93 0.03
94 0.02
95 0.02
96 0.02
97 0.02
98 0.02
99 0.02
100 0.02
101 0.02
102 0.02
103 0.02
104 0.02
105 0.02
106 0.02
107 0.02
108 0.02
109 0.02
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.06
118 0.08
119 0.12
120 0.12
121 0.14
122 0.16
123 0.17
124 0.17
125 0.15
126 0.14
127 0.11
128 0.12
129 0.1
130 0.08
131 0.07
132 0.07
133 0.06
134 0.06
135 0.04
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.02
146 0.04