Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E4URY7

Protein Details
Accession E4URY7    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
36-56AASRRIVSRRRRRRDVSMVRDHydrophilic
NLS Segment(s)
PositionSequence
38-49SRRIVSRRRRRR
96-102RSKYKGK
Subcellular Location(s) nucl 20.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MESSLELRSEWEASGQNIDTEQPVKHFRYDKQIRAAASRRIVSRRRRRRDVSMVRDAEVVCPSRKILFMRQRKGESSFSCVSKTADNVMTHKREGRSKYKGKNRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.16
4 0.15
5 0.15
6 0.14
7 0.14
8 0.14
9 0.14
10 0.19
11 0.21
12 0.26
13 0.29
14 0.3
15 0.39
16 0.47
17 0.49
18 0.52
19 0.53
20 0.49
21 0.51
22 0.53
23 0.48
24 0.45
25 0.42
26 0.37
27 0.4
28 0.46
29 0.5
30 0.57
31 0.62
32 0.67
33 0.72
34 0.75
35 0.77
36 0.8
37 0.8
38 0.77
39 0.75
40 0.67
41 0.59
42 0.55
43 0.46
44 0.36
45 0.28
46 0.22
47 0.13
48 0.12
49 0.12
50 0.12
51 0.14
52 0.15
53 0.23
54 0.31
55 0.4
56 0.48
57 0.54
58 0.56
59 0.57
60 0.59
61 0.56
62 0.48
63 0.46
64 0.42
65 0.37
66 0.35
67 0.34
68 0.31
69 0.26
70 0.25
71 0.23
72 0.24
73 0.25
74 0.27
75 0.34
76 0.36
77 0.37
78 0.41
79 0.41
80 0.43
81 0.48
82 0.53
83 0.56
84 0.62
85 0.71