Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C3YI23

Protein Details
Accession A0A1C3YI23    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-81KYTPDGRNEKKQQLRQHMSQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10.5, mito 10, nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023580  RNA_pol_su_RPB10  
IPR020789  RNA_pol_suN_Zn-BS  
IPR000268  RPABC5/Rpb10  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF01194  RNA_pol_N  
PROSITE View protein in PROSITE  
PS01112  RNA_POL_N_8KD  
Amino Acid Sequences MIIPIRCFSCGKVTGDLWERYLQLISDPRKTDGDAMDELGLKRYCCRRMIMTHVDLIEKLLKYTPDGRNEKKQQLRQHMSQEQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.38
4 0.33
5 0.3
6 0.27
7 0.24
8 0.24
9 0.18
10 0.15
11 0.21
12 0.22
13 0.26
14 0.27
15 0.29
16 0.29
17 0.3
18 0.29
19 0.23
20 0.23
21 0.17
22 0.16
23 0.15
24 0.15
25 0.14
26 0.16
27 0.15
28 0.11
29 0.14
30 0.18
31 0.2
32 0.21
33 0.23
34 0.24
35 0.27
36 0.35
37 0.39
38 0.35
39 0.35
40 0.34
41 0.32
42 0.27
43 0.25
44 0.21
45 0.14
46 0.13
47 0.13
48 0.13
49 0.15
50 0.24
51 0.28
52 0.34
53 0.42
54 0.48
55 0.57
56 0.64
57 0.72
58 0.73
59 0.75
60 0.75
61 0.79
62 0.81
63 0.77
64 0.79