Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RVT9

Protein Details
Accession I1RVT9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
197-226DKDGDVKPPKPKKIKAKKELEKNKNKWQEFBasic
NLS Segment(s)
PositionSequence
202-238VKPPKPKKIKAKKELEKNKNKWQEFSAKSKGGKSTKK
Subcellular Location(s) nucl 16, cyto_nucl 12.333, mito_nucl 8.833, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002999  Tudor  
IPR043560  ZGPAT  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0045892  P:negative regulation of DNA-templated transcription  
KEGG fgr:FGSG_08383  -  
CDD cd20446  Tudor_SpSPF30-like  
Amino Acid Sequences MSSIAEIEGEKKAYQEQFEIVLGQLRDDPDNVELKALKDELNSFIDLLSEQIAELKPAQASKPAPKQPSPPPEPEKWSRENHPAFKKAAPTEEKEQAAPANYQVNDTVLAKWVSGDKGFYQARITSITGSSTNPIYVVKFKTYDNTETLQARDIRPISNKRKADGTPTTSAPATPSAPGLVTSAGATVYPDAKKEADKDGDVKPPKPKKIKAKKELEKNKNKWQEFSAKSKGGKSTKKDSMFRTPDGVHGRVGFTGSGQAMRKDPTRSRHIYQVNDELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.23
4 0.24
5 0.24
6 0.24
7 0.19
8 0.21
9 0.18
10 0.17
11 0.17
12 0.16
13 0.17
14 0.16
15 0.18
16 0.16
17 0.19
18 0.19
19 0.19
20 0.19
21 0.19
22 0.22
23 0.21
24 0.19
25 0.17
26 0.19
27 0.2
28 0.21
29 0.2
30 0.17
31 0.16
32 0.15
33 0.13
34 0.12
35 0.09
36 0.07
37 0.06
38 0.09
39 0.09
40 0.1
41 0.1
42 0.11
43 0.11
44 0.13
45 0.14
46 0.17
47 0.21
48 0.28
49 0.37
50 0.43
51 0.47
52 0.5
53 0.56
54 0.6
55 0.66
56 0.63
57 0.62
58 0.61
59 0.61
60 0.65
61 0.65
62 0.62
63 0.58
64 0.57
65 0.54
66 0.57
67 0.6
68 0.61
69 0.62
70 0.6
71 0.56
72 0.54
73 0.55
74 0.46
75 0.46
76 0.41
77 0.39
78 0.4
79 0.43
80 0.41
81 0.35
82 0.34
83 0.28
84 0.26
85 0.21
86 0.17
87 0.17
88 0.16
89 0.16
90 0.15
91 0.15
92 0.14
93 0.14
94 0.13
95 0.1
96 0.1
97 0.1
98 0.1
99 0.11
100 0.1
101 0.1
102 0.1
103 0.08
104 0.15
105 0.16
106 0.16
107 0.16
108 0.15
109 0.16
110 0.18
111 0.18
112 0.11
113 0.12
114 0.12
115 0.12
116 0.11
117 0.11
118 0.09
119 0.09
120 0.08
121 0.08
122 0.08
123 0.1
124 0.11
125 0.12
126 0.13
127 0.13
128 0.17
129 0.2
130 0.21
131 0.2
132 0.2
133 0.21
134 0.21
135 0.22
136 0.21
137 0.21
138 0.19
139 0.2
140 0.19
141 0.19
142 0.24
143 0.33
144 0.37
145 0.44
146 0.45
147 0.42
148 0.47
149 0.45
150 0.47
151 0.44
152 0.42
153 0.36
154 0.36
155 0.36
156 0.31
157 0.3
158 0.24
159 0.19
160 0.14
161 0.11
162 0.11
163 0.09
164 0.09
165 0.1
166 0.09
167 0.07
168 0.07
169 0.06
170 0.06
171 0.06
172 0.05
173 0.05
174 0.05
175 0.08
176 0.08
177 0.09
178 0.11
179 0.12
180 0.14
181 0.16
182 0.21
183 0.21
184 0.23
185 0.26
186 0.28
187 0.36
188 0.38
189 0.4
190 0.44
191 0.49
192 0.56
193 0.62
194 0.67
195 0.69
196 0.77
197 0.84
198 0.84
199 0.87
200 0.87
201 0.89
202 0.92
203 0.91
204 0.91
205 0.88
206 0.88
207 0.87
208 0.8
209 0.72
210 0.66
211 0.66
212 0.6
213 0.61
214 0.58
215 0.54
216 0.55
217 0.56
218 0.58
219 0.57
220 0.6
221 0.58
222 0.6
223 0.63
224 0.69
225 0.7
226 0.68
227 0.7
228 0.68
229 0.64
230 0.6
231 0.52
232 0.51
233 0.52
234 0.47
235 0.38
236 0.33
237 0.31
238 0.26
239 0.26
240 0.19
241 0.13
242 0.15
243 0.13
244 0.17
245 0.17
246 0.19
247 0.21
248 0.25
249 0.29
250 0.33
251 0.4
252 0.43
253 0.51
254 0.55
255 0.57
256 0.64
257 0.67
258 0.66
259 0.66