Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1C3YIT4

Protein Details
Accession A0A1C3YIT4   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-50SRNARERRTTTRSPRRRRRRQSGASLASRHydrophilic
NLS Segment(s)
PositionSequence
26-73RERRTTTRSPRRRRRRQSGASLASRRPSTPPQLRVPEPRRSGLRRLSR
Subcellular Location(s) nucl 16.5, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MRSSCLVMRRFGGLPTHTSLSSRNARERRTTTRSPRRRRRRQSGASLASRRPSTPPQLRVPEPRRSGLRRLSRLVRADLRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.29
4 0.25
5 0.25
6 0.25
7 0.26
8 0.32
9 0.33
10 0.38
11 0.41
12 0.44
13 0.51
14 0.55
15 0.57
16 0.57
17 0.61
18 0.63
19 0.69
20 0.76
21 0.8
22 0.85
23 0.87
24 0.91
25 0.92
26 0.92
27 0.92
28 0.89
29 0.88
30 0.87
31 0.83
32 0.79
33 0.73
34 0.64
35 0.57
36 0.49
37 0.4
38 0.34
39 0.31
40 0.33
41 0.38
42 0.42
43 0.47
44 0.52
45 0.56
46 0.63
47 0.64
48 0.64
49 0.6
50 0.59
51 0.59
52 0.57
53 0.6
54 0.6
55 0.64
56 0.61
57 0.65
58 0.66
59 0.66
60 0.66
61 0.66