Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UZ28

Protein Details
Accession E4UZ28   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
89-117KEEDGKKSKGLKKERKKWKKDDMQMLNIMBasic
NLS Segment(s)
PositionSequence
91-108EDGKKSKGLKKERKKWKK
Subcellular Location(s) nucl 16, mito 6, cyto 3
Family & Domain DBs
Amino Acid Sequences MGKDSDSVARRTCGLEAYPVKQAAYLSTTSIFIRRGNFAYDPMKGFLESPGPQGRPSMVIKGLQNSWIYRQQHIYIIYLRPDNIYNIKKEEDGKKSKGLKKERKKWKKDDMQMLNIMLPAGDCILSSPSKLREPIHICADELA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.26
3 0.27
4 0.29
5 0.33
6 0.32
7 0.31
8 0.29
9 0.28
10 0.21
11 0.2
12 0.17
13 0.14
14 0.14
15 0.15
16 0.14
17 0.17
18 0.16
19 0.16
20 0.17
21 0.19
22 0.19
23 0.22
24 0.22
25 0.24
26 0.25
27 0.25
28 0.25
29 0.23
30 0.22
31 0.19
32 0.18
33 0.15
34 0.17
35 0.15
36 0.18
37 0.21
38 0.21
39 0.21
40 0.21
41 0.2
42 0.19
43 0.2
44 0.18
45 0.15
46 0.17
47 0.17
48 0.19
49 0.19
50 0.18
51 0.18
52 0.16
53 0.18
54 0.22
55 0.23
56 0.22
57 0.24
58 0.22
59 0.24
60 0.25
61 0.23
62 0.19
63 0.19
64 0.19
65 0.18
66 0.17
67 0.14
68 0.14
69 0.14
70 0.18
71 0.2
72 0.2
73 0.22
74 0.23
75 0.23
76 0.27
77 0.32
78 0.34
79 0.39
80 0.4
81 0.46
82 0.54
83 0.57
84 0.62
85 0.66
86 0.68
87 0.72
88 0.8
89 0.83
90 0.85
91 0.89
92 0.9
93 0.9
94 0.9
95 0.88
96 0.89
97 0.85
98 0.81
99 0.74
100 0.65
101 0.54
102 0.44
103 0.34
104 0.23
105 0.15
106 0.09
107 0.06
108 0.05
109 0.04
110 0.05
111 0.08
112 0.09
113 0.1
114 0.14
115 0.18
116 0.22
117 0.27
118 0.27
119 0.34
120 0.4
121 0.45
122 0.49
123 0.46