Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S8Q1

Protein Details
Accession I1S8Q1    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MCCGSSRRHGGRRVRRNGSDSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, plas 4, nucl 2, pero 2, cyto 1, E.R. 1, golg 1
Family & Domain DBs
KEGG fgr:FGSG_13229  -  
Amino Acid Sequences MCCGSSRRHGGRRVRRNGSDSDAYSVAYSDVMEGRKSFMMRNIRPSGFPIVLPTEPQTVATGAPCLPRSPNRSQETFLSTAVPPEAARSPEEMLVGERIPSQVVKRTEEGSPSSTVSFTLVELLIFCSLLVQLGRIKVVGMFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.77
4 0.73
5 0.69
6 0.64
7 0.55
8 0.49
9 0.4
10 0.34
11 0.3
12 0.25
13 0.18
14 0.12
15 0.1
16 0.06
17 0.09
18 0.1
19 0.1
20 0.1
21 0.12
22 0.15
23 0.15
24 0.15
25 0.2
26 0.29
27 0.31
28 0.39
29 0.43
30 0.41
31 0.41
32 0.43
33 0.41
34 0.32
35 0.29
36 0.23
37 0.2
38 0.19
39 0.2
40 0.18
41 0.15
42 0.15
43 0.15
44 0.14
45 0.1
46 0.1
47 0.1
48 0.09
49 0.08
50 0.1
51 0.1
52 0.09
53 0.11
54 0.16
55 0.22
56 0.27
57 0.36
58 0.37
59 0.38
60 0.39
61 0.4
62 0.39
63 0.34
64 0.29
65 0.22
66 0.19
67 0.17
68 0.16
69 0.14
70 0.09
71 0.09
72 0.11
73 0.09
74 0.1
75 0.12
76 0.13
77 0.13
78 0.14
79 0.12
80 0.11
81 0.12
82 0.11
83 0.09
84 0.09
85 0.08
86 0.09
87 0.09
88 0.1
89 0.16
90 0.19
91 0.22
92 0.23
93 0.25
94 0.26
95 0.28
96 0.3
97 0.25
98 0.24
99 0.22
100 0.21
101 0.19
102 0.18
103 0.16
104 0.13
105 0.1
106 0.1
107 0.09
108 0.08
109 0.08
110 0.1
111 0.09
112 0.08
113 0.08
114 0.06
115 0.06
116 0.08
117 0.07
118 0.08
119 0.1
120 0.12
121 0.13
122 0.12
123 0.13