Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S6Q9

Protein Details
Accession I1S6Q9   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-72KCPPCVTKGEERKKKAKEAGBasic
NLS Segment(s)
PositionSequence
63-73ERKKKAKEAGR
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 3
Family & Domain DBs
KEGG fgr:FGSG_12532  -  
Amino Acid Sequences MCAYIRQLTKCENCSEILMDDSSRAYQCQTNKEGRPCQDVFLTLGTKYVGPDKCPPCVTKGEERKKKAKEAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.25
4 0.2
5 0.18
6 0.15
7 0.14
8 0.13
9 0.12
10 0.11
11 0.1
12 0.1
13 0.13
14 0.16
15 0.21
16 0.25
17 0.31
18 0.36
19 0.42
20 0.46
21 0.45
22 0.48
23 0.42
24 0.39
25 0.33
26 0.28
27 0.23
28 0.2
29 0.18
30 0.12
31 0.12
32 0.11
33 0.1
34 0.1
35 0.16
36 0.15
37 0.17
38 0.27
39 0.28
40 0.33
41 0.36
42 0.37
43 0.34
44 0.39
45 0.41
46 0.43
47 0.51
48 0.57
49 0.64
50 0.71
51 0.77
52 0.76
53 0.8