Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RPL1

Protein Details
Accession I1RPL1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
136-156DGNKKEEKSKGKKRKLFIFVHBasic
NLS Segment(s)
PositionSequence
139-150KKEEKSKGKKRK
Subcellular Location(s) mito 20, nucl 3.5, cyto_nucl 3.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023582  Impact  
IPR001498  Impact_N  
IPR036956  Impact_N_sf  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR020569  UPF0029_Impact_CS  
KEGG fgr:FGSG_05984  -  
Pfam View protein in Pfam  
PF01205  UPF0029  
PROSITE View protein in PROSITE  
PS00910  UPF0029  
Amino Acid Sequences MAAKRAAQSILPKSQPPSWTPSKRISEFIAHVSPVTCPSQASSYVDSLLESDKRIRNATHNITAWRIRGDGPGHQQFNDDGETGAGSRLLQLMQSMDLWDSMVVVTRWYGGTHLGSKRFRFITAAASDAFARAGMDGNKKEEKSKGKKRKLFIFVHRDLREKAVDPLLARLNSCDEFDWAHAVGQSGTRGQVGLTKDFPELSEHPSWMTRNLISIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.48
3 0.43
4 0.44
5 0.46
6 0.51
7 0.53
8 0.59
9 0.62
10 0.61
11 0.61
12 0.57
13 0.53
14 0.48
15 0.49
16 0.42
17 0.33
18 0.31
19 0.28
20 0.24
21 0.21
22 0.2
23 0.14
24 0.12
25 0.14
26 0.16
27 0.17
28 0.2
29 0.2
30 0.19
31 0.2
32 0.2
33 0.18
34 0.16
35 0.17
36 0.14
37 0.13
38 0.18
39 0.21
40 0.23
41 0.25
42 0.26
43 0.3
44 0.38
45 0.42
46 0.43
47 0.42
48 0.41
49 0.43
50 0.44
51 0.38
52 0.31
53 0.25
54 0.19
55 0.21
56 0.21
57 0.22
58 0.28
59 0.33
60 0.33
61 0.32
62 0.32
63 0.28
64 0.28
65 0.24
66 0.17
67 0.1
68 0.09
69 0.09
70 0.08
71 0.08
72 0.06
73 0.04
74 0.04
75 0.05
76 0.05
77 0.04
78 0.05
79 0.05
80 0.05
81 0.06
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.04
88 0.04
89 0.05
90 0.04
91 0.04
92 0.04
93 0.05
94 0.05
95 0.05
96 0.06
97 0.06
98 0.07
99 0.12
100 0.15
101 0.2
102 0.23
103 0.24
104 0.27
105 0.27
106 0.26
107 0.23
108 0.21
109 0.21
110 0.19
111 0.2
112 0.16
113 0.16
114 0.16
115 0.14
116 0.13
117 0.07
118 0.06
119 0.04
120 0.06
121 0.08
122 0.13
123 0.14
124 0.18
125 0.22
126 0.23
127 0.25
128 0.3
129 0.37
130 0.43
131 0.54
132 0.6
133 0.67
134 0.73
135 0.78
136 0.81
137 0.8
138 0.78
139 0.77
140 0.75
141 0.72
142 0.75
143 0.7
144 0.64
145 0.56
146 0.51
147 0.44
148 0.36
149 0.32
150 0.26
151 0.25
152 0.22
153 0.25
154 0.27
155 0.25
156 0.23
157 0.21
158 0.22
159 0.21
160 0.22
161 0.18
162 0.14
163 0.15
164 0.16
165 0.18
166 0.14
167 0.14
168 0.13
169 0.13
170 0.13
171 0.13
172 0.13
173 0.11
174 0.11
175 0.11
176 0.1
177 0.1
178 0.14
179 0.15
180 0.18
181 0.19
182 0.21
183 0.21
184 0.22
185 0.22
186 0.24
187 0.23
188 0.25
189 0.26
190 0.25
191 0.26
192 0.3
193 0.31
194 0.28
195 0.3
196 0.24