Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1S7G4

Protein Details
Accession I1S7G4    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MLVKYNKSRKDRKTAPCPCTLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.166, nucl 12, mito 12
Family & Domain DBs
KEGG fgr:FGSG_12787  -  
Amino Acid Sequences MLVKYNKSRKDRKTAPCPCTLSESTEHSRCRPFSIDRVYWSRYDTNATSVHVWHCSSVEAEQGSANAVFIIGQTEEKTDTTWKEKKRREADPVEGFIYATLEFQLCHLRLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.82
3 0.81
4 0.77
5 0.67
6 0.65
7 0.56
8 0.49
9 0.42
10 0.43
11 0.4
12 0.42
13 0.42
14 0.38
15 0.42
16 0.39
17 0.39
18 0.37
19 0.34
20 0.36
21 0.42
22 0.42
23 0.41
24 0.45
25 0.44
26 0.4
27 0.39
28 0.33
29 0.25
30 0.27
31 0.22
32 0.21
33 0.2
34 0.2
35 0.18
36 0.17
37 0.17
38 0.15
39 0.14
40 0.11
41 0.1
42 0.09
43 0.09
44 0.08
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.04
54 0.04
55 0.03
56 0.03
57 0.05
58 0.04
59 0.05
60 0.05
61 0.06
62 0.08
63 0.08
64 0.09
65 0.11
66 0.14
67 0.21
68 0.28
69 0.36
70 0.46
71 0.53
72 0.62
73 0.68
74 0.73
75 0.74
76 0.75
77 0.76
78 0.73
79 0.69
80 0.6
81 0.52
82 0.44
83 0.35
84 0.28
85 0.18
86 0.11
87 0.08
88 0.07
89 0.07
90 0.08
91 0.16