Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E4UP96

Protein Details
Accession E4UP96   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
84-115KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MLGLRSLLSTPSKLPLSQITSAYPRRICQTVFLRTFSQTSWGSLSTRSIWKASETLSTGLKSLCSRGVRSLGQTRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.3
4 0.31
5 0.31
6 0.29
7 0.34
8 0.38
9 0.41
10 0.37
11 0.33
12 0.34
13 0.35
14 0.32
15 0.33
16 0.37
17 0.4
18 0.41
19 0.42
20 0.39
21 0.38
22 0.39
23 0.31
24 0.29
25 0.2
26 0.19
27 0.17
28 0.17
29 0.16
30 0.16
31 0.17
32 0.15
33 0.17
34 0.17
35 0.16
36 0.15
37 0.16
38 0.16
39 0.15
40 0.15
41 0.14
42 0.14
43 0.14
44 0.14
45 0.13
46 0.12
47 0.13
48 0.1
49 0.1
50 0.13
51 0.13
52 0.14
53 0.16
54 0.2
55 0.2
56 0.24
57 0.3
58 0.27
59 0.33
60 0.33
61 0.33
62 0.36
63 0.37
64 0.33
65 0.29
66 0.37
67 0.37
68 0.43
69 0.45
70 0.42
71 0.49
72 0.53
73 0.54
74 0.52
75 0.53
76 0.55
77 0.6
78 0.65
79 0.66
80 0.73
81 0.78
82 0.77
83 0.79
84 0.8
85 0.79
86 0.78
87 0.78
88 0.76
89 0.77
90 0.79
91 0.75
92 0.75
93 0.77
94 0.81
95 0.82