Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S6H5

Protein Details
Accession I1S6H5   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
79-105RYSSSIFPKQNKRRKKCDAPNNAMLQCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.833, cyto 6, cyto_mito 3.833
Family & Domain DBs
KEGG fgr:FGSG_12446  -  
Amino Acid Sequences MMLVQDELGDFCVHMVGHSEFWSLDPEVEVSGRPYLIIFHPTLCLVEPDFADGKGDIDIHLKVAGKQSGEFTGSASGSRYSSSIFPKQNKRRKKCDAPNNAMLQCNFITSNPSSERSCCASLCGYHGNDNAIDRRAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.11
3 0.11
4 0.12
5 0.13
6 0.14
7 0.13
8 0.14
9 0.17
10 0.13
11 0.12
12 0.11
13 0.11
14 0.11
15 0.11
16 0.11
17 0.09
18 0.1
19 0.09
20 0.08
21 0.08
22 0.09
23 0.1
24 0.13
25 0.12
26 0.11
27 0.12
28 0.13
29 0.13
30 0.12
31 0.11
32 0.09
33 0.1
34 0.09
35 0.11
36 0.11
37 0.1
38 0.11
39 0.1
40 0.09
41 0.08
42 0.09
43 0.06
44 0.07
45 0.07
46 0.07
47 0.09
48 0.08
49 0.09
50 0.12
51 0.12
52 0.11
53 0.12
54 0.12
55 0.12
56 0.12
57 0.11
58 0.09
59 0.09
60 0.09
61 0.09
62 0.09
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.11
69 0.15
70 0.21
71 0.27
72 0.34
73 0.44
74 0.55
75 0.63
76 0.71
77 0.74
78 0.77
79 0.81
80 0.85
81 0.85
82 0.85
83 0.87
84 0.84
85 0.84
86 0.81
87 0.73
88 0.64
89 0.54
90 0.46
91 0.35
92 0.29
93 0.21
94 0.15
95 0.17
96 0.15
97 0.21
98 0.21
99 0.24
100 0.24
101 0.25
102 0.29
103 0.3
104 0.31
105 0.26
106 0.26
107 0.25
108 0.25
109 0.28
110 0.3
111 0.27
112 0.3
113 0.31
114 0.31
115 0.29
116 0.31
117 0.3