Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RPE0

Protein Details
Accession I1RPE0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
97-125HGFLVRKRSKTGRRILLRRKIKGRRNIAQBasic
NLS Segment(s)
PositionSequence
94-122KRRHGFLVRKRSKTGRRILLRRKIKGRRN
Subcellular Location(s) mito 23, mito_nucl 13.333, cyto_mito 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG fgr:FGSG_05907  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFSSITRLARPVLAKSLAQSPRTFTTLVPLRPSLTPMNGAIRRSVLPSSFTPSVAASADIVPSSAITEHPALGGMQIRCGPRNTMNGHTRLVQKRRHGFLVRKRSKTGRRILLRRKIKGRRNIAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.35
4 0.36
5 0.36
6 0.34
7 0.33
8 0.34
9 0.35
10 0.34
11 0.24
12 0.28
13 0.32
14 0.34
15 0.33
16 0.31
17 0.31
18 0.31
19 0.34
20 0.27
21 0.21
22 0.21
23 0.18
24 0.26
25 0.26
26 0.27
27 0.24
28 0.24
29 0.23
30 0.23
31 0.22
32 0.15
33 0.15
34 0.16
35 0.21
36 0.2
37 0.2
38 0.18
39 0.17
40 0.17
41 0.14
42 0.13
43 0.08
44 0.07
45 0.07
46 0.06
47 0.06
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.05
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.06
60 0.11
61 0.09
62 0.1
63 0.13
64 0.14
65 0.15
66 0.17
67 0.19
68 0.18
69 0.25
70 0.27
71 0.32
72 0.36
73 0.37
74 0.38
75 0.39
76 0.44
77 0.46
78 0.49
79 0.48
80 0.52
81 0.58
82 0.61
83 0.65
84 0.64
85 0.65
86 0.68
87 0.73
88 0.74
89 0.7
90 0.72
91 0.74
92 0.76
93 0.76
94 0.75
95 0.74
96 0.75
97 0.81
98 0.85
99 0.86
100 0.87
101 0.87
102 0.88
103 0.88
104 0.87
105 0.87