Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1RMQ0

Protein Details
Accession I1RMQ0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
335-364KEAEYKRALKQKKKDKWKKDPSKAVKEPHPBasic
NLS Segment(s)
PositionSequence
340-361KRALKQKKKDKWKKDPSKAVKE
415-438RGGRRGDSRGRGGRGRGNGRGGRG
Subcellular Location(s) cyto 13, cyto_nucl 10, cysk 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038664  Gar1/Naf1_Cbf5-bd_sf  
IPR007504  H/ACA_rnp_Gar1/Naf1  
IPR040309  Naf1  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005732  C:sno(s)RNA-containing ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0000493  P:box H/ACA snoRNP assembly  
GO:0001522  P:pseudouridine synthesis  
GO:0042254  P:ribosome biogenesis  
KEGG fgr:FGSG_05244  -  
Pfam View protein in Pfam  
PF04410  Gar1  
Amino Acid Sequences MSGFEIPGLGQAKPNETLPPLPPTDVLVAAASFQDTEIPDAAPSETKNESAPVTIEPKPSEGQPVPAADADAMAIDRPESPPSLTGALEAALGGLAPVQPAQTAQPAPAANTETVPLQNDQGDNPEWEVDSSPYESSSESSSSESSDDDSDNEGYELLGVEETARLLMQADGGASDDEGNQGAKGSTAAQIRTKNEIPEEVIPKPDITITPEMKVEELGVIEHIVENIMLVKAFTPGEYQVLDSGSVLCTSERVVIGAVAETIGKVLQPMYTVRFTTDQDIKDLGLEVGQKVFYPVDHASYVFTEPLKNLKGSDASNLHDEEVGDDEMEFSDDEKEAEYKRALKQKKKDKWKKDPSKAVKEPHPLRQESRPDVTLNYDDEDDGPYKPLARPPGYGSGPSTTETYEPPSGRNFNQRGGRRGDSRGRGGRGRGNGRGGRGGFNQPRDGYSLPPQGAHQPVQQTGPPAAWPGAQPPAQGAAPAMPNFGFQMPGWPQVPPQGNAGAVPPPPPGWPNAQGQQGANGGAFVNPAFFAALMSTMQAQQQNGQSPWGQQQPPNNGNGNGQGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.25
4 0.29
5 0.28
6 0.33
7 0.31
8 0.31
9 0.3
10 0.3
11 0.29
12 0.25
13 0.23
14 0.17
15 0.15
16 0.14
17 0.13
18 0.11
19 0.08
20 0.07
21 0.09
22 0.09
23 0.11
24 0.12
25 0.12
26 0.12
27 0.13
28 0.14
29 0.14
30 0.14
31 0.16
32 0.17
33 0.17
34 0.18
35 0.19
36 0.19
37 0.18
38 0.19
39 0.18
40 0.22
41 0.25
42 0.29
43 0.28
44 0.3
45 0.3
46 0.3
47 0.34
48 0.3
49 0.3
50 0.3
51 0.3
52 0.29
53 0.28
54 0.27
55 0.19
56 0.18
57 0.13
58 0.1
59 0.08
60 0.06
61 0.06
62 0.06
63 0.07
64 0.08
65 0.1
66 0.11
67 0.12
68 0.14
69 0.16
70 0.18
71 0.16
72 0.15
73 0.14
74 0.13
75 0.11
76 0.1
77 0.07
78 0.05
79 0.04
80 0.04
81 0.04
82 0.03
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.07
89 0.12
90 0.12
91 0.12
92 0.17
93 0.17
94 0.18
95 0.2
96 0.21
97 0.17
98 0.17
99 0.17
100 0.14
101 0.15
102 0.16
103 0.14
104 0.13
105 0.15
106 0.15
107 0.15
108 0.17
109 0.18
110 0.17
111 0.17
112 0.16
113 0.14
114 0.14
115 0.15
116 0.12
117 0.12
118 0.13
119 0.12
120 0.12
121 0.12
122 0.12
123 0.12
124 0.13
125 0.12
126 0.12
127 0.13
128 0.13
129 0.13
130 0.13
131 0.13
132 0.12
133 0.12
134 0.12
135 0.11
136 0.13
137 0.12
138 0.12
139 0.12
140 0.1
141 0.08
142 0.08
143 0.07
144 0.05
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.06
166 0.06
167 0.05
168 0.06
169 0.05
170 0.05
171 0.06
172 0.06
173 0.1
174 0.12
175 0.14
176 0.19
177 0.23
178 0.25
179 0.31
180 0.31
181 0.29
182 0.28
183 0.28
184 0.26
185 0.27
186 0.29
187 0.24
188 0.24
189 0.22
190 0.21
191 0.2
192 0.18
193 0.13
194 0.13
195 0.19
196 0.18
197 0.19
198 0.2
199 0.2
200 0.19
201 0.19
202 0.15
203 0.09
204 0.07
205 0.06
206 0.05
207 0.05
208 0.05
209 0.05
210 0.04
211 0.04
212 0.03
213 0.03
214 0.04
215 0.04
216 0.04
217 0.03
218 0.04
219 0.05
220 0.05
221 0.06
222 0.06
223 0.07
224 0.08
225 0.08
226 0.08
227 0.08
228 0.08
229 0.08
230 0.07
231 0.07
232 0.06
233 0.06
234 0.06
235 0.05
236 0.05
237 0.05
238 0.07
239 0.06
240 0.06
241 0.06
242 0.06
243 0.06
244 0.06
245 0.05
246 0.04
247 0.04
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.03
254 0.03
255 0.05
256 0.06
257 0.09
258 0.1
259 0.11
260 0.12
261 0.14
262 0.14
263 0.18
264 0.21
265 0.19
266 0.19
267 0.19
268 0.18
269 0.16
270 0.16
271 0.11
272 0.08
273 0.08
274 0.06
275 0.06
276 0.06
277 0.06
278 0.06
279 0.06
280 0.05
281 0.09
282 0.09
283 0.1
284 0.11
285 0.11
286 0.11
287 0.12
288 0.13
289 0.1
290 0.1
291 0.08
292 0.08
293 0.12
294 0.12
295 0.12
296 0.12
297 0.12
298 0.15
299 0.15
300 0.19
301 0.17
302 0.17
303 0.19
304 0.19
305 0.18
306 0.16
307 0.15
308 0.11
309 0.11
310 0.1
311 0.07
312 0.07
313 0.07
314 0.06
315 0.07
316 0.06
317 0.04
318 0.05
319 0.05
320 0.06
321 0.06
322 0.08
323 0.08
324 0.11
325 0.12
326 0.15
327 0.2
328 0.29
329 0.36
330 0.43
331 0.52
332 0.61
333 0.69
334 0.77
335 0.82
336 0.84
337 0.88
338 0.91
339 0.93
340 0.92
341 0.93
342 0.91
343 0.92
344 0.88
345 0.83
346 0.79
347 0.78
348 0.72
349 0.7
350 0.67
351 0.59
352 0.55
353 0.57
354 0.57
355 0.52
356 0.51
357 0.44
358 0.38
359 0.36
360 0.36
361 0.3
362 0.24
363 0.2
364 0.17
365 0.15
366 0.14
367 0.15
368 0.13
369 0.11
370 0.12
371 0.1
372 0.12
373 0.13
374 0.17
375 0.22
376 0.23
377 0.24
378 0.27
379 0.35
380 0.34
381 0.34
382 0.32
383 0.28
384 0.27
385 0.26
386 0.23
387 0.16
388 0.15
389 0.15
390 0.18
391 0.21
392 0.2
393 0.21
394 0.25
395 0.28
396 0.3
397 0.39
398 0.36
399 0.38
400 0.46
401 0.5
402 0.5
403 0.53
404 0.56
405 0.5
406 0.55
407 0.56
408 0.53
409 0.56
410 0.57
411 0.55
412 0.54
413 0.53
414 0.52
415 0.52
416 0.52
417 0.48
418 0.5
419 0.48
420 0.46
421 0.48
422 0.43
423 0.39
424 0.36
425 0.41
426 0.39
427 0.4
428 0.42
429 0.37
430 0.37
431 0.37
432 0.35
433 0.29
434 0.31
435 0.35
436 0.3
437 0.3
438 0.3
439 0.32
440 0.35
441 0.34
442 0.3
443 0.27
444 0.28
445 0.3
446 0.3
447 0.27
448 0.24
449 0.22
450 0.19
451 0.17
452 0.16
453 0.15
454 0.14
455 0.15
456 0.2
457 0.2
458 0.19
459 0.19
460 0.21
461 0.2
462 0.2
463 0.17
464 0.14
465 0.17
466 0.17
467 0.17
468 0.14
469 0.14
470 0.16
471 0.15
472 0.14
473 0.1
474 0.18
475 0.19
476 0.24
477 0.24
478 0.23
479 0.23
480 0.3
481 0.34
482 0.28
483 0.28
484 0.26
485 0.25
486 0.25
487 0.26
488 0.22
489 0.18
490 0.18
491 0.17
492 0.16
493 0.17
494 0.18
495 0.19
496 0.22
497 0.26
498 0.31
499 0.35
500 0.39
501 0.4
502 0.39
503 0.41
504 0.36
505 0.32
506 0.25
507 0.2
508 0.15
509 0.12
510 0.12
511 0.08
512 0.07
513 0.06
514 0.07
515 0.07
516 0.06
517 0.06
518 0.06
519 0.08
520 0.07
521 0.08
522 0.09
523 0.1
524 0.13
525 0.16
526 0.16
527 0.2
528 0.25
529 0.31
530 0.31
531 0.33
532 0.31
533 0.32
534 0.39
535 0.42
536 0.41
537 0.38
538 0.46
539 0.54
540 0.56
541 0.58
542 0.55
543 0.48
544 0.47