Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S6K5

Protein Details
Accession I1S6K5    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-42NEASSMSRRRRHPIKKRRGKKRYYKKLNTEPTDSNHydrophilic
NLS Segment(s)
PositionSequence
15-32RRRRHPIKKRRGKKRYYK
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG fgr:FGSG_12477  -  
Amino Acid Sequences MPMLLVDNEASSMSRRRRHPIKKRRGKKRYYKKLNTEPTDSNSRHTTPHITVVEPQQLLTENEVSVDLENLGEDNIAHCFMTKDDTDPKLVGKSKPVVSFCHPDTLSELQSNSPRLSLEKVCLIDDRTCQGLTSKAIGVCEPLNVYEMFEKLKRKRSFARLYRSWLTATLLSSRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.37
3 0.46
4 0.56
5 0.67
6 0.76
7 0.79
8 0.83
9 0.87
10 0.93
11 0.95
12 0.95
13 0.94
14 0.94
15 0.94
16 0.94
17 0.94
18 0.94
19 0.93
20 0.93
21 0.93
22 0.87
23 0.82
24 0.74
25 0.68
26 0.67
27 0.57
28 0.5
29 0.43
30 0.39
31 0.35
32 0.33
33 0.33
34 0.26
35 0.34
36 0.31
37 0.28
38 0.29
39 0.31
40 0.34
41 0.29
42 0.27
43 0.19
44 0.2
45 0.19
46 0.18
47 0.15
48 0.1
49 0.1
50 0.1
51 0.1
52 0.08
53 0.07
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.08
69 0.08
70 0.09
71 0.14
72 0.15
73 0.16
74 0.16
75 0.17
76 0.18
77 0.21
78 0.2
79 0.19
80 0.22
81 0.25
82 0.29
83 0.3
84 0.29
85 0.3
86 0.34
87 0.31
88 0.34
89 0.3
90 0.26
91 0.28
92 0.28
93 0.25
94 0.21
95 0.21
96 0.16
97 0.19
98 0.21
99 0.17
100 0.15
101 0.14
102 0.14
103 0.18
104 0.17
105 0.17
106 0.19
107 0.2
108 0.2
109 0.21
110 0.23
111 0.21
112 0.21
113 0.21
114 0.19
115 0.18
116 0.17
117 0.17
118 0.17
119 0.17
120 0.18
121 0.18
122 0.17
123 0.18
124 0.17
125 0.19
126 0.16
127 0.15
128 0.13
129 0.1
130 0.11
131 0.11
132 0.12
133 0.12
134 0.12
135 0.14
136 0.18
137 0.26
138 0.31
139 0.41
140 0.44
141 0.49
142 0.58
143 0.65
144 0.73
145 0.73
146 0.77
147 0.74
148 0.78
149 0.75
150 0.68
151 0.59
152 0.5
153 0.44
154 0.37
155 0.32