Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I1RZ01

Protein Details
Accession I1RZ01    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-69VDENGRRLRWRRKDTNPKVEDBasic
NLS Segment(s)
Subcellular Location(s) extr 9, E.R. 8, golg 5, mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG fgr:FGSG_09618  -  
Amino Acid Sequences MPPLLHPKSRMTSSLFATTVAACFIVVTIPHMLPCPVPRTRFADGDIMVDENGRRLRWRRKDTNPKVEDGIVQFNDMSTEEAENAQDRTKRECPLPKPGGVLGEWLFFHKNDNEAGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.32
4 0.3
5 0.27
6 0.21
7 0.17
8 0.13
9 0.07
10 0.06
11 0.06
12 0.05
13 0.05
14 0.07
15 0.08
16 0.09
17 0.09
18 0.1
19 0.1
20 0.11
21 0.13
22 0.17
23 0.18
24 0.2
25 0.23
26 0.29
27 0.32
28 0.32
29 0.32
30 0.31
31 0.27
32 0.27
33 0.24
34 0.18
35 0.14
36 0.13
37 0.11
38 0.09
39 0.1
40 0.09
41 0.11
42 0.16
43 0.27
44 0.36
45 0.45
46 0.52
47 0.62
48 0.73
49 0.8
50 0.85
51 0.77
52 0.69
53 0.62
54 0.54
55 0.45
56 0.35
57 0.3
58 0.19
59 0.18
60 0.15
61 0.13
62 0.13
63 0.12
64 0.11
65 0.07
66 0.07
67 0.07
68 0.08
69 0.09
70 0.09
71 0.1
72 0.12
73 0.15
74 0.16
75 0.23
76 0.27
77 0.3
78 0.36
79 0.44
80 0.46
81 0.54
82 0.57
83 0.52
84 0.51
85 0.5
86 0.44
87 0.36
88 0.35
89 0.25
90 0.22
91 0.2
92 0.19
93 0.19
94 0.17
95 0.2
96 0.18
97 0.19