Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RFM8

Protein Details
Accession I1RFM8   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKSSRASTKKANNRRLVKNVFHydrophilic
75-106DSVKKPSSGRIEKKRPDKRKQQSSKITFKSYGHydrophilic
NLS Segment(s)
PositionSequence
78-118KKPSSGRIEKKRPDKRKQQSSKITFKSYGSRSKGKGKKKSA
Subcellular Location(s) nucl 16, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG fgr:FGSG_02508  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRASTKKANNRRLVKNVFGPAEAARNERLSAKLLEVAKQPKPESSDVNMNTEEETNESNEDAQEETTMDVDSVKKPSSGRIEKKRPDKRKQQSSKITFKSYGSRSKGKGKKKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.85
4 0.8
5 0.75
6 0.71
7 0.67
8 0.58
9 0.5
10 0.43
11 0.34
12 0.33
13 0.28
14 0.23
15 0.19
16 0.19
17 0.19
18 0.19
19 0.19
20 0.17
21 0.17
22 0.16
23 0.19
24 0.18
25 0.2
26 0.24
27 0.27
28 0.28
29 0.31
30 0.31
31 0.28
32 0.31
33 0.31
34 0.3
35 0.28
36 0.33
37 0.3
38 0.33
39 0.3
40 0.27
41 0.25
42 0.21
43 0.18
44 0.11
45 0.1
46 0.07
47 0.08
48 0.07
49 0.07
50 0.06
51 0.07
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.05
60 0.05
61 0.07
62 0.08
63 0.1
64 0.11
65 0.12
66 0.12
67 0.18
68 0.27
69 0.36
70 0.44
71 0.52
72 0.62
73 0.69
74 0.8
75 0.85
76 0.86
77 0.86
78 0.88
79 0.88
80 0.89
81 0.91
82 0.91
83 0.91
84 0.89
85 0.9
86 0.85
87 0.8
88 0.72
89 0.64
90 0.62
91 0.58
92 0.58
93 0.54
94 0.55
95 0.54
96 0.63
97 0.68
98 0.7