Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S617

Protein Details
Accession I1S617    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-58GTASRLVGRRIRKNHRRRPLFRRSAAIHydrophilic
NLS Segment(s)
PositionSequence
36-54RLVGRRIRKNHRRRPLFRR
Subcellular Location(s) mito 16.5, mito_nucl 13, nucl 8.5
Family & Domain DBs
KEGG fgr:FGSG_12288  -  
Amino Acid Sequences MKLALASSQLAQFFTSPRGGLSAPTPTRQRGGTASRLVGRRIRKNHRRRPLFRRSAAILQDDRVLSPFSSLTMEDKKQGEAPERHRPDAEDSMEICSVEPPPDNPTSASPVAAEITSLCFLPQSIREHQERAKRPQLQDVDMTDDTETLLPMDTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.14
4 0.14
5 0.16
6 0.15
7 0.16
8 0.17
9 0.23
10 0.24
11 0.29
12 0.31
13 0.31
14 0.33
15 0.33
16 0.33
17 0.29
18 0.33
19 0.35
20 0.35
21 0.36
22 0.39
23 0.4
24 0.4
25 0.4
26 0.43
27 0.44
28 0.5
29 0.58
30 0.64
31 0.73
32 0.81
33 0.86
34 0.88
35 0.88
36 0.88
37 0.89
38 0.88
39 0.8
40 0.75
41 0.69
42 0.64
43 0.57
44 0.52
45 0.41
46 0.32
47 0.31
48 0.25
49 0.21
50 0.16
51 0.15
52 0.1
53 0.1
54 0.09
55 0.07
56 0.08
57 0.08
58 0.1
59 0.13
60 0.13
61 0.16
62 0.16
63 0.16
64 0.18
65 0.19
66 0.23
67 0.25
68 0.31
69 0.38
70 0.41
71 0.42
72 0.4
73 0.4
74 0.38
75 0.38
76 0.33
77 0.25
78 0.22
79 0.23
80 0.23
81 0.22
82 0.16
83 0.11
84 0.1
85 0.09
86 0.09
87 0.08
88 0.12
89 0.13
90 0.14
91 0.15
92 0.16
93 0.2
94 0.2
95 0.2
96 0.16
97 0.15
98 0.15
99 0.14
100 0.12
101 0.06
102 0.08
103 0.08
104 0.08
105 0.07
106 0.07
107 0.07
108 0.09
109 0.14
110 0.17
111 0.22
112 0.27
113 0.3
114 0.35
115 0.41
116 0.48
117 0.51
118 0.55
119 0.59
120 0.62
121 0.62
122 0.67
123 0.66
124 0.6
125 0.57
126 0.51
127 0.49
128 0.41
129 0.4
130 0.31
131 0.25
132 0.23
133 0.18
134 0.15
135 0.08