Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1S540

Protein Details
Accession I1S540    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
141-166EPPKQTSNASSKKRARNRKAGLQALLHydrophilic
NLS Segment(s)
PositionSequence
75-86RKSMRPKTKGKK
149-159ASSKKRARNRK
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
KEGG fgr:FGSG_11958  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MSLAEIPGTIDFLTDAAHLLRTTAPETSAHLMSHRGNLLSQFGVSPSDVQRQHVCGGCGLIMIPGQETILKLEARKSMRPKTKGKKSGINSTPKDNNEGPCKILHCDNCQRDTKIVFPAPAPAVRRKTAQNKVKKTVAPVEPPKQTSNASSKKRARNRKAGLQALLSGQKQQSANPLSLSHFMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.08
5 0.08
6 0.09
7 0.1
8 0.11
9 0.13
10 0.13
11 0.13
12 0.13
13 0.17
14 0.19
15 0.2
16 0.18
17 0.18
18 0.21
19 0.21
20 0.24
21 0.22
22 0.19
23 0.17
24 0.18
25 0.2
26 0.16
27 0.15
28 0.11
29 0.1
30 0.11
31 0.11
32 0.12
33 0.12
34 0.19
35 0.19
36 0.22
37 0.24
38 0.25
39 0.28
40 0.28
41 0.26
42 0.19
43 0.19
44 0.16
45 0.14
46 0.11
47 0.08
48 0.06
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.08
57 0.09
58 0.09
59 0.12
60 0.17
61 0.2
62 0.26
63 0.31
64 0.38
65 0.46
66 0.53
67 0.6
68 0.65
69 0.72
70 0.75
71 0.73
72 0.73
73 0.69
74 0.73
75 0.69
76 0.68
77 0.59
78 0.56
79 0.57
80 0.48
81 0.49
82 0.41
83 0.38
84 0.34
85 0.33
86 0.29
87 0.25
88 0.25
89 0.22
90 0.24
91 0.23
92 0.24
93 0.32
94 0.35
95 0.38
96 0.41
97 0.41
98 0.39
99 0.38
100 0.34
101 0.31
102 0.29
103 0.25
104 0.21
105 0.24
106 0.23
107 0.25
108 0.25
109 0.26
110 0.28
111 0.29
112 0.32
113 0.35
114 0.43
115 0.5
116 0.56
117 0.6
118 0.64
119 0.68
120 0.72
121 0.67
122 0.62
123 0.6
124 0.57
125 0.56
126 0.56
127 0.57
128 0.56
129 0.57
130 0.54
131 0.48
132 0.44
133 0.4
134 0.42
135 0.44
136 0.45
137 0.53
138 0.6
139 0.67
140 0.76
141 0.82
142 0.81
143 0.83
144 0.85
145 0.85
146 0.86
147 0.82
148 0.76
149 0.66
150 0.59
151 0.52
152 0.49
153 0.39
154 0.33
155 0.27
156 0.28
157 0.27
158 0.26
159 0.31
160 0.29
161 0.3
162 0.28
163 0.3
164 0.28