Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

I1RZW8

Protein Details
Accession I1RZW8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPQAKKSGKAQKQTKKYIIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002671  Ribosomal_L22e  
IPR038526  Ribosomal_L22e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG fgr:FGSG_09974  -  
Pfam View protein in Pfam  
PF01776  Ribosomal_L22e  
Amino Acid Sequences MAPQAKKSGKAQKQTKKYIIDASQPASDKIFDVAAFEKFLQDRIKVEGRTNNLGDNVVVKQQGEGKIEIIAHNELSGRYLKYLTKKFLKKQQLRDWLRVVSTSRGVYELKFFNVVNDEADEDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.77
4 0.73
5 0.71
6 0.65
7 0.62
8 0.56
9 0.5
10 0.47
11 0.42
12 0.39
13 0.32
14 0.27
15 0.2
16 0.17
17 0.15
18 0.1
19 0.11
20 0.12
21 0.11
22 0.12
23 0.12
24 0.13
25 0.12
26 0.15
27 0.15
28 0.15
29 0.15
30 0.19
31 0.24
32 0.23
33 0.26
34 0.28
35 0.3
36 0.34
37 0.33
38 0.29
39 0.24
40 0.23
41 0.2
42 0.16
43 0.13
44 0.1
45 0.09
46 0.08
47 0.08
48 0.11
49 0.14
50 0.14
51 0.13
52 0.12
53 0.13
54 0.14
55 0.14
56 0.12
57 0.1
58 0.08
59 0.08
60 0.08
61 0.07
62 0.08
63 0.1
64 0.08
65 0.08
66 0.1
67 0.13
68 0.21
69 0.26
70 0.31
71 0.39
72 0.45
73 0.52
74 0.6
75 0.68
76 0.69
77 0.74
78 0.78
79 0.8
80 0.78
81 0.77
82 0.72
83 0.63
84 0.56
85 0.48
86 0.41
87 0.34
88 0.32
89 0.27
90 0.23
91 0.23
92 0.23
93 0.21
94 0.24
95 0.22
96 0.2
97 0.22
98 0.21
99 0.21
100 0.24
101 0.24
102 0.2
103 0.19
104 0.18