Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5R1L1

Protein Details
Accession E5R1L1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-34TLVPVGKRRSRSQKPRKPESQKARIAHHydrophilic
NLS Segment(s)
PositionSequence
14-32KRRSRSQKPRKPESQKARI
Subcellular Location(s) mito 18, cyto 6.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MSSDWTETLVPVGKRRSRSQKPRKPESQKARIAHGVFLARRPGPPQAQPIHGGSAGSAIASHTKNVFWDVVIPRFTMGGGGGPNNLAKCRVSHPFGGEENIREEHHFYDKKVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.49
3 0.58
4 0.63
5 0.73
6 0.78
7 0.79
8 0.84
9 0.89
10 0.91
11 0.9
12 0.9
13 0.89
14 0.88
15 0.87
16 0.79
17 0.74
18 0.7
19 0.61
20 0.51
21 0.43
22 0.38
23 0.29
24 0.29
25 0.27
26 0.21
27 0.21
28 0.21
29 0.23
30 0.22
31 0.24
32 0.29
33 0.28
34 0.29
35 0.31
36 0.3
37 0.27
38 0.24
39 0.2
40 0.14
41 0.11
42 0.09
43 0.07
44 0.05
45 0.04
46 0.07
47 0.07
48 0.08
49 0.07
50 0.08
51 0.08
52 0.1
53 0.1
54 0.07
55 0.12
56 0.14
57 0.17
58 0.18
59 0.18
60 0.16
61 0.16
62 0.16
63 0.11
64 0.09
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.09
71 0.1
72 0.1
73 0.1
74 0.1
75 0.12
76 0.16
77 0.22
78 0.24
79 0.27
80 0.29
81 0.33
82 0.34
83 0.36
84 0.33
85 0.29
86 0.3
87 0.29
88 0.27
89 0.24
90 0.24
91 0.23
92 0.3
93 0.31