Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E5R2P3

Protein Details
Accession E5R2P3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
170-192ESENSSSKKRAKMRKQKGLLASLHydrophilic
NLS Segment(s)
PositionSequence
177-186KKRAKMRKQK
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MSQPVSARLDFLKASARLLSQQSPSTSAHLMTAHNKTAIQDKSSRLSIKDQMEACPACGSVRTPGMNSRVFTRTQPLPKAARPVHKSRHKKLSQDVLSHPSAQKCLVYECLRCAHEVVQRLPQSARPVHRKRKASPMAIASSSTSYQMPLRTAVDQTERLAPGSATPKMESENSSSKKRAKMRKQKGLLASLATQKQSKASSSLGLLDFLQSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.23
4 0.24
5 0.28
6 0.31
7 0.27
8 0.31
9 0.3
10 0.32
11 0.32
12 0.31
13 0.28
14 0.24
15 0.22
16 0.2
17 0.21
18 0.24
19 0.27
20 0.25
21 0.25
22 0.25
23 0.24
24 0.3
25 0.3
26 0.27
27 0.28
28 0.29
29 0.33
30 0.37
31 0.38
32 0.32
33 0.35
34 0.39
35 0.38
36 0.4
37 0.37
38 0.34
39 0.38
40 0.36
41 0.32
42 0.25
43 0.22
44 0.16
45 0.16
46 0.15
47 0.12
48 0.16
49 0.16
50 0.16
51 0.2
52 0.25
53 0.27
54 0.27
55 0.28
56 0.26
57 0.26
58 0.26
59 0.27
60 0.29
61 0.32
62 0.34
63 0.35
64 0.37
65 0.38
66 0.47
67 0.46
68 0.48
69 0.47
70 0.52
71 0.57
72 0.63
73 0.69
74 0.68
75 0.74
76 0.7
77 0.7
78 0.68
79 0.69
80 0.64
81 0.59
82 0.55
83 0.49
84 0.45
85 0.42
86 0.37
87 0.27
88 0.22
89 0.18
90 0.16
91 0.11
92 0.11
93 0.15
94 0.16
95 0.16
96 0.17
97 0.2
98 0.2
99 0.2
100 0.2
101 0.18
102 0.19
103 0.22
104 0.22
105 0.26
106 0.26
107 0.27
108 0.27
109 0.26
110 0.28
111 0.28
112 0.33
113 0.36
114 0.45
115 0.54
116 0.61
117 0.65
118 0.64
119 0.71
120 0.72
121 0.66
122 0.61
123 0.56
124 0.52
125 0.46
126 0.43
127 0.32
128 0.26
129 0.22
130 0.18
131 0.13
132 0.11
133 0.12
134 0.13
135 0.13
136 0.13
137 0.15
138 0.15
139 0.16
140 0.17
141 0.19
142 0.19
143 0.2
144 0.23
145 0.21
146 0.2
147 0.2
148 0.17
149 0.17
150 0.21
151 0.22
152 0.19
153 0.19
154 0.2
155 0.21
156 0.23
157 0.21
158 0.23
159 0.3
160 0.33
161 0.38
162 0.42
163 0.45
164 0.52
165 0.59
166 0.64
167 0.66
168 0.72
169 0.78
170 0.84
171 0.86
172 0.85
173 0.83
174 0.78
175 0.69
176 0.61
177 0.53
178 0.5
179 0.46
180 0.4
181 0.35
182 0.3
183 0.32
184 0.3
185 0.29
186 0.25
187 0.24
188 0.24
189 0.25
190 0.29
191 0.26
192 0.24
193 0.22